Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EA09

Protein Details
Accession A0A1Y2EA09   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
85-104DDDRNFKHKRITKDNKSSSHBasic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 15.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045137  RBM26/27  
Gene Ontology GO:0003723  F:RNA binding  
Amino Acid Sequences MIIEDDKKELLKQHLISILEPICDADPDTLADYVIALLSPDIPDKELKNLINSQLEEFLKSEKSSDLKRSRDDAEEQKEDSDQSDDDRNFKHKRITKDNKSSSHSTKPEHEEQTQPPNKKIEQKIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.36
4 0.36
5 0.32
6 0.24
7 0.23
8 0.19
9 0.14
10 0.13
11 0.14
12 0.09
13 0.08
14 0.09
15 0.11
16 0.1
17 0.09
18 0.09
19 0.08
20 0.07
21 0.06
22 0.05
23 0.03
24 0.03
25 0.04
26 0.04
27 0.05
28 0.05
29 0.07
30 0.09
31 0.09
32 0.13
33 0.17
34 0.17
35 0.2
36 0.21
37 0.23
38 0.25
39 0.25
40 0.22
41 0.22
42 0.22
43 0.19
44 0.18
45 0.16
46 0.13
47 0.13
48 0.13
49 0.1
50 0.12
51 0.14
52 0.23
53 0.29
54 0.31
55 0.34
56 0.37
57 0.38
58 0.38
59 0.41
60 0.39
61 0.39
62 0.38
63 0.36
64 0.33
65 0.31
66 0.28
67 0.24
68 0.18
69 0.11
70 0.11
71 0.17
72 0.17
73 0.19
74 0.21
75 0.27
76 0.29
77 0.31
78 0.39
79 0.38
80 0.47
81 0.56
82 0.65
83 0.69
84 0.76
85 0.82
86 0.8
87 0.8
88 0.78
89 0.73
90 0.72
91 0.66
92 0.6
93 0.59
94 0.59
95 0.61
96 0.6
97 0.57
98 0.54
99 0.54
100 0.61
101 0.62
102 0.59
103 0.55
104 0.55
105 0.57
106 0.6