Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H0EMF6

Protein Details
Accession H0EMF6    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
110-133WEDIDRRSKARRKRGQDSNERMETHydrophilic
NLS Segment(s)
PositionSequence
116-123RSKARRKR
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 4, mito 3, pero 3
Family & Domain DBs
Amino Acid Sequences MNTEVATKIAEEAEALATQLSKSIAELQQRREEADKIHDLLITRIETSAEQILFLEYHIAEMEDDYEANQSELQFLRIQLQAIQTQYNELLPQNRDEELSESIRNWKIDWEDIDRRSKARRKRGQDSNERMETGKDVDKITIMTNEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.08
6 0.09
7 0.08
8 0.06
9 0.07
10 0.13
11 0.17
12 0.25
13 0.3
14 0.34
15 0.41
16 0.42
17 0.44
18 0.41
19 0.39
20 0.33
21 0.35
22 0.33
23 0.27
24 0.27
25 0.26
26 0.24
27 0.23
28 0.23
29 0.17
30 0.14
31 0.12
32 0.12
33 0.1
34 0.12
35 0.14
36 0.1
37 0.1
38 0.1
39 0.1
40 0.09
41 0.09
42 0.08
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.04
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.06
57 0.05
58 0.06
59 0.07
60 0.08
61 0.08
62 0.08
63 0.11
64 0.11
65 0.11
66 0.11
67 0.13
68 0.13
69 0.14
70 0.14
71 0.11
72 0.12
73 0.12
74 0.11
75 0.09
76 0.09
77 0.12
78 0.12
79 0.14
80 0.15
81 0.15
82 0.15
83 0.15
84 0.17
85 0.17
86 0.19
87 0.17
88 0.16
89 0.21
90 0.24
91 0.23
92 0.21
93 0.21
94 0.2
95 0.23
96 0.26
97 0.29
98 0.33
99 0.37
100 0.44
101 0.42
102 0.42
103 0.48
104 0.52
105 0.54
106 0.58
107 0.64
108 0.66
109 0.75
110 0.83
111 0.84
112 0.87
113 0.87
114 0.85
115 0.79
116 0.71
117 0.62
118 0.53
119 0.44
120 0.37
121 0.33
122 0.27
123 0.24
124 0.23
125 0.24
126 0.23
127 0.23