Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2EG61

Protein Details
Accession A0A1Y2EG61    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
93-114GSNDRCGKKYGRCKNGKCCSKYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR001002  Chitin-bd_1  
IPR018371  Chitin-binding_1_CS  
IPR036861  Endochitinase-like_sf  
Gene Ontology GO:0008061  F:chitin binding  
Pfam View protein in Pfam  
PF00187  Chitin_bind_1  
PROSITE View protein in PROSITE  
PS00026  CHIT_BIND_I_1  
PS50941  CHIT_BIND_I_2  
CDD cd00035  ChtBD1  
Amino Acid Sequences MEFKLRTIILAYIALIALISNVYAQIDILITSTTSEPAAVEDIQPTINNYRCGKDFNNKSCSNGECCSKYGYCGTSDAYCGSKCQSKYGLCYGSNDRCGKKYGRCKNGKCCSKYGYCGRSKDYCKAGCQPIYGICK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.06
4 0.05
5 0.04
6 0.04
7 0.03
8 0.03
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.05
16 0.05
17 0.05
18 0.06
19 0.06
20 0.07
21 0.07
22 0.07
23 0.06
24 0.07
25 0.09
26 0.08
27 0.08
28 0.08
29 0.09
30 0.09
31 0.09
32 0.1
33 0.12
34 0.15
35 0.2
36 0.21
37 0.22
38 0.23
39 0.27
40 0.29
41 0.34
42 0.4
43 0.42
44 0.48
45 0.46
46 0.48
47 0.47
48 0.45
49 0.4
50 0.33
51 0.3
52 0.24
53 0.24
54 0.24
55 0.21
56 0.21
57 0.18
58 0.17
59 0.14
60 0.14
61 0.14
62 0.12
63 0.13
64 0.13
65 0.12
66 0.11
67 0.11
68 0.12
69 0.16
70 0.16
71 0.18
72 0.23
73 0.23
74 0.27
75 0.33
76 0.36
77 0.31
78 0.35
79 0.38
80 0.38
81 0.43
82 0.43
83 0.39
84 0.35
85 0.39
86 0.4
87 0.43
88 0.48
89 0.51
90 0.58
91 0.66
92 0.73
93 0.8
94 0.86
95 0.86
96 0.8
97 0.75
98 0.71
99 0.66
100 0.67
101 0.65
102 0.64
103 0.62
104 0.62
105 0.62
106 0.65
107 0.64
108 0.64
109 0.63
110 0.58
111 0.56
112 0.59
113 0.62
114 0.56
115 0.53
116 0.48