Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2EIT8

Protein Details
Accession A0A1Y2EIT8    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGRKGNKKYRKEIRKEQREREKDVLFBasic
121-149NKNPNLKKETINKRTRRKSKYCSKKKKYKBasic
NLS Segment(s)
PositionSequence
3-20RKGNKKYRKEIRKEQRER
128-149KETINKRTRRKSKYCSKKKKYK
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MGRKGNKKYRKEIRKEQREREKDVLFWKLGKQLSDPLGEYRQFISNLRNKEINEVDDFIDIPINLVDLTANLITSLITGENSLYESINESDRRLAALNNINEDLIMKNESSNERTTSNCINKNPNLKKETINKRTRRKSKYCSKKKKYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.92
4 0.92
5 0.88
6 0.86
7 0.83
8 0.74
9 0.67
10 0.62
11 0.57
12 0.48
13 0.43
14 0.37
15 0.36
16 0.35
17 0.32
18 0.28
19 0.28
20 0.29
21 0.29
22 0.28
23 0.25
24 0.27
25 0.27
26 0.26
27 0.22
28 0.22
29 0.21
30 0.21
31 0.26
32 0.27
33 0.31
34 0.33
35 0.34
36 0.31
37 0.36
38 0.37
39 0.31
40 0.27
41 0.25
42 0.22
43 0.19
44 0.19
45 0.13
46 0.12
47 0.09
48 0.07
49 0.05
50 0.05
51 0.04
52 0.04
53 0.04
54 0.03
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.05
70 0.05
71 0.05
72 0.06
73 0.07
74 0.11
75 0.11
76 0.11
77 0.12
78 0.12
79 0.13
80 0.12
81 0.11
82 0.14
83 0.2
84 0.21
85 0.22
86 0.22
87 0.21
88 0.2
89 0.2
90 0.15
91 0.1
92 0.1
93 0.08
94 0.08
95 0.11
96 0.14
97 0.16
98 0.18
99 0.19
100 0.19
101 0.21
102 0.25
103 0.31
104 0.36
105 0.4
106 0.42
107 0.47
108 0.52
109 0.62
110 0.66
111 0.65
112 0.62
113 0.58
114 0.61
115 0.64
116 0.69
117 0.69
118 0.71
119 0.72
120 0.79
121 0.87
122 0.9
123 0.9
124 0.89
125 0.89
126 0.9
127 0.92
128 0.92
129 0.93