Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2BY51

Protein Details
Accession A0A1Y2BY51    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-34RGTMGRSKKQQINKNKNKNEVANHydrophilic
94-116TTDKIRTDTRSKRRESRKSSFLAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito_nucl 13.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MLRYNFERKPLRGTMGRSKKQQINKNKNKNEVANSSSQINNIPLKNEDFIKNEDINDEIIYKNRMEKSKPKSWKDSWKRPLNQTIIFEDFESSTTDKIRTDTRSKRRESRKSSFLADMLITAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.61
3 0.66
4 0.65
5 0.68
6 0.69
7 0.72
8 0.74
9 0.75
10 0.75
11 0.8
12 0.84
13 0.84
14 0.85
15 0.82
16 0.79
17 0.74
18 0.68
19 0.61
20 0.54
21 0.48
22 0.42
23 0.36
24 0.3
25 0.25
26 0.22
27 0.23
28 0.19
29 0.19
30 0.18
31 0.19
32 0.2
33 0.21
34 0.21
35 0.19
36 0.21
37 0.24
38 0.23
39 0.21
40 0.2
41 0.18
42 0.16
43 0.13
44 0.12
45 0.08
46 0.08
47 0.09
48 0.09
49 0.12
50 0.15
51 0.17
52 0.2
53 0.28
54 0.35
55 0.44
56 0.53
57 0.54
58 0.59
59 0.64
60 0.71
61 0.73
62 0.76
63 0.76
64 0.77
65 0.78
66 0.76
67 0.77
68 0.72
69 0.66
70 0.58
71 0.53
72 0.45
73 0.4
74 0.34
75 0.27
76 0.21
77 0.17
78 0.17
79 0.13
80 0.11
81 0.12
82 0.13
83 0.13
84 0.15
85 0.19
86 0.23
87 0.32
88 0.42
89 0.51
90 0.59
91 0.66
92 0.74
93 0.8
94 0.84
95 0.84
96 0.83
97 0.81
98 0.77
99 0.75
100 0.69
101 0.59
102 0.51
103 0.41