Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BPX8

Protein Details
Accession A0A1Y2BPX8    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-27ITLWLLPKKEKAKHKKYATLMSMHydrophilic
NLS Segment(s)
PositionSequence
13-19KEKAKHK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008937  Ras-like_GEF  
IPR023578  Ras_GEF_dom_sf  
IPR001895  RASGEF_cat_dom  
IPR036964  RASGEF_cat_dom_sf  
Gene Ontology GO:0005085  F:guanyl-nucleotide exchange factor activity  
GO:0007264  P:small GTPase mediated signal transduction  
Pfam View protein in Pfam  
PF00617  RasGEF  
PROSITE View protein in PROSITE  
PS50009  RASGEF_CAT  
Amino Acid Sequences MIKKITLWLLPKKEKAKHKKYATLMSMERNSEEYRKYFQECKGAKIPYLGLYLSDITYLFEAIEKEKTLSQVKLEQKLKLDKLLAEFEELQKAANYQFNEIKWIQNELNSEKFINEIQQTQDEHYLTSIQLEPKKNKTDQDSVSDRPTHNLSVKSVLNKLINNHQKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.78
3 0.79
4 0.8
5 0.82
6 0.83
7 0.82
8 0.83
9 0.76
10 0.73
11 0.66
12 0.63
13 0.58
14 0.49
15 0.43
16 0.36
17 0.34
18 0.3
19 0.3
20 0.26
21 0.26
22 0.29
23 0.33
24 0.35
25 0.37
26 0.44
27 0.42
28 0.45
29 0.48
30 0.45
31 0.41
32 0.38
33 0.35
34 0.28
35 0.28
36 0.22
37 0.15
38 0.15
39 0.14
40 0.12
41 0.11
42 0.08
43 0.07
44 0.07
45 0.07
46 0.05
47 0.06
48 0.06
49 0.07
50 0.09
51 0.09
52 0.1
53 0.1
54 0.14
55 0.15
56 0.16
57 0.16
58 0.23
59 0.26
60 0.34
61 0.35
62 0.34
63 0.35
64 0.4
65 0.39
66 0.34
67 0.3
68 0.23
69 0.23
70 0.23
71 0.19
72 0.15
73 0.15
74 0.13
75 0.14
76 0.13
77 0.11
78 0.09
79 0.09
80 0.08
81 0.11
82 0.11
83 0.13
84 0.15
85 0.15
86 0.2
87 0.2
88 0.21
89 0.18
90 0.22
91 0.19
92 0.19
93 0.22
94 0.21
95 0.23
96 0.22
97 0.21
98 0.18
99 0.18
100 0.16
101 0.16
102 0.14
103 0.13
104 0.14
105 0.18
106 0.19
107 0.2
108 0.23
109 0.2
110 0.19
111 0.18
112 0.16
113 0.13
114 0.14
115 0.15
116 0.16
117 0.22
118 0.29
119 0.34
120 0.4
121 0.47
122 0.48
123 0.5
124 0.52
125 0.55
126 0.52
127 0.55
128 0.54
129 0.51
130 0.54
131 0.53
132 0.47
133 0.42
134 0.41
135 0.38
136 0.37
137 0.36
138 0.33
139 0.34
140 0.37
141 0.38
142 0.37
143 0.38
144 0.37
145 0.37
146 0.39
147 0.44