Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DZD1

Protein Details
Accession A0A1Y2DZD1    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
125-152WYARGFCKHGPNCRHKHVRKIICQNYISHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, cyto_nucl 8.833, mito 8, cyto 6.5, cyto_pero 4.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR045348  CPSF4/Yth1  
IPR041367  Znf-CCCH_4  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003723  F:RNA binding  
GO:0098789  P:pre-mRNA cleavage required for polyadenylation  
Pfam View protein in Pfam  
PF00642  zf-CCCH  
PF14608  zf-CCCH_2  
PF18044  zf-CCCH_4  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences METLEKELNQAEKLNFSFEDYIKNELNISLENNTVNVETCKYFQKGQCTKGNNCQYRHARPEKTVVCKHWLRGLCKKGDLCEFLHEYNLKKMPECWFYSKYGECSNPECMYLHVDPESKVRECAWYARGFCKHGPNCRHKHVRKIICQNYISGFCPKGPDCDQGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.25
4 0.27
5 0.23
6 0.29
7 0.26
8 0.3
9 0.27
10 0.27
11 0.24
12 0.21
13 0.22
14 0.16
15 0.16
16 0.13
17 0.13
18 0.13
19 0.13
20 0.13
21 0.12
22 0.12
23 0.11
24 0.11
25 0.11
26 0.13
27 0.17
28 0.19
29 0.24
30 0.26
31 0.36
32 0.4
33 0.45
34 0.52
35 0.53
36 0.55
37 0.6
38 0.67
39 0.63
40 0.59
41 0.62
42 0.61
43 0.62
44 0.67
45 0.65
46 0.58
47 0.54
48 0.61
49 0.57
50 0.58
51 0.56
52 0.49
53 0.48
54 0.46
55 0.45
56 0.42
57 0.41
58 0.39
59 0.42
60 0.45
61 0.41
62 0.43
63 0.42
64 0.38
65 0.36
66 0.33
67 0.25
68 0.23
69 0.23
70 0.19
71 0.21
72 0.2
73 0.18
74 0.2
75 0.23
76 0.2
77 0.18
78 0.2
79 0.22
80 0.26
81 0.28
82 0.3
83 0.28
84 0.3
85 0.34
86 0.33
87 0.31
88 0.31
89 0.3
90 0.27
91 0.27
92 0.29
93 0.26
94 0.25
95 0.23
96 0.2
97 0.22
98 0.2
99 0.19
100 0.16
101 0.16
102 0.16
103 0.2
104 0.23
105 0.19
106 0.2
107 0.19
108 0.2
109 0.2
110 0.24
111 0.25
112 0.26
113 0.28
114 0.34
115 0.37
116 0.38
117 0.4
118 0.46
119 0.48
120 0.51
121 0.59
122 0.62
123 0.66
124 0.72
125 0.8
126 0.75
127 0.8
128 0.81
129 0.81
130 0.81
131 0.85
132 0.83
133 0.81
134 0.76
135 0.68
136 0.62
137 0.56
138 0.48
139 0.42
140 0.35
141 0.27
142 0.32
143 0.31
144 0.32
145 0.33