Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Z1I8

Protein Details
Accession A0A1Y1Z1I8    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MNTWTQKKITLRQRRRGCYLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5mito_nucl 12.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001602  UPF0047_YjbQ  
IPR035917  YjbQ-like_sf  
Pfam View protein in Pfam  
PF01894  UPF0047  
PROSITE View protein in PROSITE  
PS01314  UPF0047  
Amino Acid Sequences MNTWTQKKITLRQRRRGCYLVTDEILSQISSELSEYKCGMANIFIQHSSASLTINENYDPDVRTDMEMMLNRLAPENAPYIHTMEGSDDMPAHVKSSLFGCSLNIPISNGKLALGTWQGIWYCEHRNSTSGRHIVVTLQGETKSNSNPNLSKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.79
4 0.71
5 0.67
6 0.64
7 0.59
8 0.5
9 0.44
10 0.37
11 0.33
12 0.31
13 0.22
14 0.15
15 0.09
16 0.08
17 0.07
18 0.07
19 0.09
20 0.09
21 0.11
22 0.12
23 0.12
24 0.14
25 0.14
26 0.14
27 0.12
28 0.14
29 0.15
30 0.16
31 0.15
32 0.13
33 0.13
34 0.13
35 0.12
36 0.1
37 0.08
38 0.08
39 0.09
40 0.1
41 0.11
42 0.11
43 0.1
44 0.11
45 0.12
46 0.12
47 0.11
48 0.11
49 0.11
50 0.11
51 0.11
52 0.1
53 0.11
54 0.11
55 0.12
56 0.11
57 0.11
58 0.1
59 0.1
60 0.1
61 0.07
62 0.08
63 0.08
64 0.08
65 0.08
66 0.09
67 0.1
68 0.1
69 0.1
70 0.09
71 0.08
72 0.09
73 0.08
74 0.08
75 0.06
76 0.06
77 0.08
78 0.08
79 0.08
80 0.07
81 0.07
82 0.07
83 0.09
84 0.1
85 0.09
86 0.1
87 0.1
88 0.1
89 0.12
90 0.12
91 0.11
92 0.11
93 0.11
94 0.12
95 0.12
96 0.11
97 0.09
98 0.09
99 0.08
100 0.09
101 0.1
102 0.09
103 0.09
104 0.11
105 0.11
106 0.11
107 0.13
108 0.14
109 0.18
110 0.21
111 0.25
112 0.24
113 0.27
114 0.29
115 0.33
116 0.39
117 0.36
118 0.34
119 0.31
120 0.3
121 0.29
122 0.31
123 0.28
124 0.21
125 0.21
126 0.2
127 0.21
128 0.22
129 0.24
130 0.24
131 0.26
132 0.27
133 0.32
134 0.37
135 0.46