Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EDD3

Protein Details
Accession A0A1Y2EDD3   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSSRKEKKILNCLKCKTKPYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 12.333, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR019407  CTU2  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0000049  F:tRNA binding  
GO:0034227  P:tRNA thio-modification  
GO:0002098  P:tRNA wobble uridine modification  
Amino Acid Sequences MSSRKEKKILNCLKCKTKPYEINIRENYPLCKECFLSFMQHKFRTNVGQAKKIKKGMNVLIALSGGNSSRALLDIFYKYIKEQKTQNPVKFKDLKKLLLRMLMIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.75
4 0.74
5 0.72
6 0.69
7 0.73
8 0.68
9 0.71
10 0.69
11 0.65
12 0.59
13 0.53
14 0.49
15 0.43
16 0.39
17 0.31
18 0.28
19 0.26
20 0.23
21 0.23
22 0.21
23 0.23
24 0.25
25 0.3
26 0.36
27 0.38
28 0.39
29 0.39
30 0.39
31 0.37
32 0.37
33 0.38
34 0.33
35 0.38
36 0.42
37 0.46
38 0.49
39 0.51
40 0.48
41 0.43
42 0.45
43 0.4
44 0.4
45 0.35
46 0.3
47 0.25
48 0.23
49 0.2
50 0.14
51 0.11
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.08
61 0.09
62 0.1
63 0.11
64 0.12
65 0.12
66 0.19
67 0.2
68 0.22
69 0.28
70 0.36
71 0.46
72 0.55
73 0.61
74 0.65
75 0.66
76 0.71
77 0.73
78 0.67
79 0.66
80 0.64
81 0.65
82 0.63
83 0.66
84 0.61
85 0.58