Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1ZTG8

Protein Details
Accession A0A1Y1ZTG8    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MNSRFKNYSFRKSYKKKIKKQLSSNDYRFRNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 8.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNSRFKNYSFRKSYKKKIKKQLSSNDYRFRNYYLKNYILRTYLLMVIVSETIYSGSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.86
3 0.85
4 0.87
5 0.91
6 0.9
7 0.9
8 0.9
9 0.87
10 0.86
11 0.83
12 0.8
13 0.71
14 0.64
15 0.54
16 0.48
17 0.45
18 0.37
19 0.37
20 0.34
21 0.37
22 0.38
23 0.4
24 0.38
25 0.34
26 0.32
27 0.27
28 0.23
29 0.19
30 0.16
31 0.14
32 0.12
33 0.11
34 0.11
35 0.09
36 0.07
37 0.06