Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FJB6

Protein Details
Accession A0A1Y2FJB6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-46NEYFYDHSRNNNRKKINRRRQIESTTVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019542  Enhancer_polycomb-like_N  
Pfam View protein in Pfam  
PF10513  EPL1  
Amino Acid Sequences MESESDRKFQETNSFLLSNNEYFYDHSRNNNRKKINRRRQIESTTVINKPIEEYQVSEVFPGININAPIKINRIKLINNNIPPEVLNENKTNVINNIVSDIYNSLNGNVLQDKNKNLKQKLDSTSSIILPKSSNDLKLKRKIEPKPITTINSFSPIKEISINTNHDYEENKIEIKRKSLKNNHDGYGFLPIVDSETENRLKLLPKPIYKYIPKSPISSNSEEENNIENEENETEEFIRFVEPSEEELLKRVEYDMDEQDMIWLNEINEIRVKNGLEMIEPLFFERVMDKNRKGMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.35
4 0.36
5 0.27
6 0.26
7 0.24
8 0.19
9 0.2
10 0.25
11 0.28
12 0.27
13 0.36
14 0.45
15 0.54
16 0.63
17 0.7
18 0.74
19 0.77
20 0.85
21 0.87
22 0.88
23 0.88
24 0.85
25 0.85
26 0.84
27 0.81
28 0.76
29 0.69
30 0.66
31 0.61
32 0.56
33 0.5
34 0.41
35 0.34
36 0.31
37 0.28
38 0.24
39 0.18
40 0.2
41 0.21
42 0.23
43 0.23
44 0.2
45 0.18
46 0.15
47 0.14
48 0.13
49 0.09
50 0.08
51 0.09
52 0.1
53 0.12
54 0.13
55 0.13
56 0.17
57 0.22
58 0.22
59 0.24
60 0.26
61 0.28
62 0.34
63 0.43
64 0.47
65 0.47
66 0.48
67 0.45
68 0.42
69 0.39
70 0.34
71 0.29
72 0.23
73 0.21
74 0.2
75 0.21
76 0.23
77 0.23
78 0.21
79 0.17
80 0.19
81 0.16
82 0.14
83 0.15
84 0.12
85 0.12
86 0.11
87 0.12
88 0.09
89 0.1
90 0.1
91 0.08
92 0.09
93 0.09
94 0.1
95 0.12
96 0.13
97 0.14
98 0.17
99 0.21
100 0.26
101 0.31
102 0.38
103 0.38
104 0.43
105 0.44
106 0.5
107 0.5
108 0.49
109 0.45
110 0.41
111 0.41
112 0.35
113 0.33
114 0.25
115 0.21
116 0.15
117 0.15
118 0.16
119 0.15
120 0.19
121 0.22
122 0.29
123 0.35
124 0.44
125 0.46
126 0.48
127 0.55
128 0.56
129 0.62
130 0.63
131 0.58
132 0.56
133 0.56
134 0.52
135 0.45
136 0.41
137 0.31
138 0.29
139 0.27
140 0.2
141 0.19
142 0.17
143 0.16
144 0.16
145 0.16
146 0.13
147 0.18
148 0.21
149 0.21
150 0.21
151 0.21
152 0.2
153 0.21
154 0.19
155 0.17
156 0.15
157 0.15
158 0.16
159 0.21
160 0.22
161 0.27
162 0.33
163 0.37
164 0.46
165 0.54
166 0.61
167 0.65
168 0.68
169 0.64
170 0.56
171 0.5
172 0.41
173 0.38
174 0.29
175 0.19
176 0.14
177 0.12
178 0.12
179 0.12
180 0.12
181 0.07
182 0.11
183 0.13
184 0.13
185 0.13
186 0.14
187 0.16
188 0.19
189 0.28
190 0.31
191 0.35
192 0.4
193 0.45
194 0.51
195 0.54
196 0.57
197 0.56
198 0.57
199 0.54
200 0.52
201 0.51
202 0.53
203 0.53
204 0.51
205 0.45
206 0.39
207 0.39
208 0.36
209 0.34
210 0.27
211 0.22
212 0.2
213 0.17
214 0.15
215 0.14
216 0.14
217 0.14
218 0.11
219 0.11
220 0.11
221 0.1
222 0.1
223 0.09
224 0.09
225 0.08
226 0.09
227 0.11
228 0.11
229 0.13
230 0.17
231 0.18
232 0.17
233 0.2
234 0.2
235 0.18
236 0.17
237 0.15
238 0.13
239 0.14
240 0.18
241 0.18
242 0.2
243 0.2
244 0.19
245 0.2
246 0.22
247 0.19
248 0.16
249 0.15
250 0.12
251 0.17
252 0.18
253 0.18
254 0.18
255 0.19
256 0.19
257 0.22
258 0.22
259 0.18
260 0.21
261 0.2
262 0.17
263 0.19
264 0.19
265 0.17
266 0.17
267 0.17
268 0.15
269 0.14
270 0.13
271 0.14
272 0.19
273 0.25
274 0.33
275 0.35