Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FCD9

Protein Details
Accession A0A1Y2FCD9    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-45QLCKIRRNPSTAIRRKRKEKKVLVLDLDEHydrophilic
NLS Segment(s)
PositionSequence
26-37STAIRRKRKEKK
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011948  Dullard_phosphatase  
IPR004274  FCP1_dom  
IPR036412  HAD-like_sf  
IPR023214  HAD_sf  
Gene Ontology GO:0016791  F:phosphatase activity  
Pfam View protein in Pfam  
PF03031  NIF  
PROSITE View protein in PROSITE  
PS50969  FCP1  
CDD cd07521  HAD_FCP1-like  
Amino Acid Sequences METNKEVNNTKEIESKQLCKIRRNPSTAIRRKRKEKKVLVLDLDETLIHSTSRGSRNHDYMIEVLLDKHICLYYVYKRPYVDSFLKKVSEWYKVVVFTASLKEYADPVIDYLDPEKKIFSKRYFRESCQFRNGIYMKDLQVIEKDLSKICLVDNSTFSFEINKENGIPIETWINDPKDRELLNLLPFLDALRFVEDVRSILSLRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.47
4 0.52
5 0.54
6 0.56
7 0.64
8 0.65
9 0.68
10 0.7
11 0.67
12 0.7
13 0.76
14 0.78
15 0.79
16 0.79
17 0.8
18 0.85
19 0.9
20 0.91
21 0.9
22 0.9
23 0.9
24 0.89
25 0.88
26 0.81
27 0.73
28 0.64
29 0.53
30 0.44
31 0.32
32 0.23
33 0.15
34 0.11
35 0.08
36 0.07
37 0.08
38 0.13
39 0.19
40 0.21
41 0.28
42 0.32
43 0.35
44 0.38
45 0.37
46 0.33
47 0.28
48 0.26
49 0.2
50 0.15
51 0.12
52 0.11
53 0.11
54 0.09
55 0.09
56 0.08
57 0.07
58 0.08
59 0.11
60 0.16
61 0.24
62 0.27
63 0.29
64 0.29
65 0.31
66 0.32
67 0.34
68 0.35
69 0.32
70 0.33
71 0.34
72 0.34
73 0.32
74 0.35
75 0.32
76 0.29
77 0.25
78 0.23
79 0.22
80 0.21
81 0.22
82 0.17
83 0.14
84 0.1
85 0.11
86 0.1
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.07
93 0.05
94 0.05
95 0.06
96 0.06
97 0.06
98 0.07
99 0.11
100 0.11
101 0.11
102 0.12
103 0.13
104 0.18
105 0.24
106 0.3
107 0.37
108 0.4
109 0.5
110 0.53
111 0.55
112 0.6
113 0.6
114 0.58
115 0.56
116 0.53
117 0.43
118 0.47
119 0.44
120 0.37
121 0.32
122 0.29
123 0.22
124 0.25
125 0.25
126 0.18
127 0.18
128 0.18
129 0.17
130 0.17
131 0.17
132 0.13
133 0.15
134 0.15
135 0.14
136 0.12
137 0.15
138 0.15
139 0.16
140 0.17
141 0.18
142 0.21
143 0.2
144 0.2
145 0.19
146 0.17
147 0.2
148 0.19
149 0.17
150 0.15
151 0.17
152 0.17
153 0.16
154 0.16
155 0.12
156 0.15
157 0.15
158 0.17
159 0.21
160 0.24
161 0.25
162 0.27
163 0.28
164 0.3
165 0.3
166 0.28
167 0.29
168 0.29
169 0.3
170 0.31
171 0.28
172 0.23
173 0.22
174 0.21
175 0.16
176 0.13
177 0.11
178 0.11
179 0.11
180 0.11
181 0.14
182 0.14
183 0.14
184 0.15
185 0.16