Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2F6W1

Protein Details
Accession A0A1Y2F6W1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
335-354YIMCKDPKIKRRLNEIWDNFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001365  A_deaminase_dom  
IPR006330  Ado/ade_deaminase  
IPR032466  Metal_Hydrolase  
Gene Ontology GO:0019239  F:deaminase activity  
Pfam View protein in Pfam  
PF00962  A_deaminase  
Amino Acid Sequences MERLDKNKYTDFVVKNYGSWEEFKDYCIKLPKIELHAHLNGSITPKVMNDLIEQRKDKEPDLAGFTVKNSINSGFELKDFFPIFNTVYRLTDNTKSIEYIARNVLNEFASDGVRYIELRSTPRQNIEKGMTKENYAQTLLSVINEINKRDDIIVRLILSIDRKSTLEQAMETVNLAIKLKTTDIIVGVDMCGNTNGGSFSRIKPAFDFARKNGLGVTIHTAEIPNSREDNLDVVNVSPSRMGHCTYLEEDLLKWAKDNNVAIEACMTSNIICQTVKSYDVHPVIDYIKNNQPFAICTDDKGVFNCDLSDEYLIFGAINNYNKKQLFEVSKKTIDYIMCKDPKIKRRLNEIWDNFSKTMKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.4
3 0.41
4 0.38
5 0.31
6 0.3
7 0.29
8 0.27
9 0.27
10 0.28
11 0.32
12 0.3
13 0.34
14 0.41
15 0.39
16 0.36
17 0.42
18 0.46
19 0.45
20 0.5
21 0.48
22 0.45
23 0.47
24 0.46
25 0.4
26 0.35
27 0.3
28 0.28
29 0.25
30 0.19
31 0.15
32 0.15
33 0.16
34 0.17
35 0.16
36 0.16
37 0.25
38 0.31
39 0.38
40 0.4
41 0.41
42 0.47
43 0.49
44 0.46
45 0.43
46 0.4
47 0.36
48 0.4
49 0.38
50 0.31
51 0.29
52 0.29
53 0.28
54 0.25
55 0.22
56 0.18
57 0.18
58 0.18
59 0.2
60 0.22
61 0.16
62 0.16
63 0.18
64 0.17
65 0.21
66 0.2
67 0.19
68 0.17
69 0.19
70 0.19
71 0.19
72 0.22
73 0.17
74 0.18
75 0.19
76 0.2
77 0.22
78 0.25
79 0.25
80 0.24
81 0.23
82 0.22
83 0.23
84 0.25
85 0.22
86 0.21
87 0.24
88 0.23
89 0.23
90 0.23
91 0.23
92 0.18
93 0.17
94 0.14
95 0.1
96 0.09
97 0.08
98 0.08
99 0.07
100 0.07
101 0.08
102 0.08
103 0.09
104 0.11
105 0.15
106 0.2
107 0.26
108 0.28
109 0.34
110 0.37
111 0.36
112 0.39
113 0.41
114 0.44
115 0.41
116 0.45
117 0.39
118 0.37
119 0.4
120 0.37
121 0.34
122 0.26
123 0.23
124 0.16
125 0.17
126 0.15
127 0.1
128 0.09
129 0.07
130 0.11
131 0.13
132 0.14
133 0.14
134 0.14
135 0.14
136 0.14
137 0.16
138 0.13
139 0.13
140 0.14
141 0.12
142 0.12
143 0.12
144 0.12
145 0.13
146 0.11
147 0.1
148 0.1
149 0.1
150 0.11
151 0.13
152 0.14
153 0.13
154 0.12
155 0.12
156 0.12
157 0.11
158 0.1
159 0.08
160 0.06
161 0.06
162 0.07
163 0.05
164 0.05
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.06
171 0.07
172 0.06
173 0.06
174 0.06
175 0.06
176 0.05
177 0.05
178 0.05
179 0.04
180 0.04
181 0.04
182 0.05
183 0.05
184 0.07
185 0.09
186 0.1
187 0.18
188 0.18
189 0.19
190 0.19
191 0.23
192 0.26
193 0.31
194 0.33
195 0.27
196 0.36
197 0.35
198 0.34
199 0.3
200 0.27
201 0.22
202 0.19
203 0.21
204 0.13
205 0.13
206 0.13
207 0.13
208 0.11
209 0.14
210 0.15
211 0.13
212 0.12
213 0.13
214 0.13
215 0.14
216 0.15
217 0.12
218 0.11
219 0.09
220 0.09
221 0.11
222 0.1
223 0.1
224 0.09
225 0.09
226 0.11
227 0.12
228 0.13
229 0.12
230 0.14
231 0.16
232 0.17
233 0.18
234 0.16
235 0.15
236 0.14
237 0.17
238 0.18
239 0.15
240 0.14
241 0.15
242 0.16
243 0.2
244 0.21
245 0.18
246 0.21
247 0.21
248 0.21
249 0.2
250 0.18
251 0.14
252 0.13
253 0.11
254 0.06
255 0.08
256 0.09
257 0.1
258 0.09
259 0.09
260 0.13
261 0.14
262 0.16
263 0.15
264 0.16
265 0.22
266 0.24
267 0.25
268 0.22
269 0.22
270 0.23
271 0.26
272 0.26
273 0.24
274 0.29
275 0.32
276 0.32
277 0.3
278 0.28
279 0.25
280 0.27
281 0.3
282 0.23
283 0.21
284 0.25
285 0.27
286 0.27
287 0.27
288 0.27
289 0.2
290 0.2
291 0.19
292 0.15
293 0.14
294 0.15
295 0.15
296 0.12
297 0.12
298 0.11
299 0.11
300 0.1
301 0.09
302 0.1
303 0.13
304 0.19
305 0.23
306 0.25
307 0.31
308 0.33
309 0.34
310 0.33
311 0.37
312 0.41
313 0.45
314 0.52
315 0.53
316 0.57
317 0.55
318 0.54
319 0.51
320 0.44
321 0.42
322 0.39
323 0.42
324 0.42
325 0.43
326 0.49
327 0.54
328 0.61
329 0.65
330 0.67
331 0.64
332 0.7
333 0.78
334 0.79
335 0.81
336 0.77
337 0.76
338 0.75
339 0.73
340 0.64