Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H0EYU0

Protein Details
Accession H0EYU0    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
85-113EWFATRLKRQRDREKREERRKEQEKFHREBasic
NLS Segment(s)
PositionSequence
91-108LKRQRDREKREERRKEQE
Subcellular Location(s) nucl 17, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MAPSTAAAVPEPETEIPRLPMPSRNPLPLSSSQEAQVRELYHARVRGYCAAEIKAPFKCRAQNRLMNACMVQHANQTEQDAAREEWFATRLKRQRDREKREERRKEQEKFHREWWGLPIEDREGEKGNEVLRRAERVGGFPKRDDKEGTLSKDRHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.2
4 0.21
5 0.23
6 0.22
7 0.28
8 0.31
9 0.4
10 0.42
11 0.45
12 0.44
13 0.42
14 0.46
15 0.45
16 0.48
17 0.41
18 0.38
19 0.35
20 0.37
21 0.37
22 0.33
23 0.29
24 0.22
25 0.22
26 0.23
27 0.23
28 0.22
29 0.25
30 0.24
31 0.23
32 0.25
33 0.27
34 0.27
35 0.26
36 0.24
37 0.23
38 0.24
39 0.24
40 0.24
41 0.23
42 0.23
43 0.23
44 0.24
45 0.3
46 0.32
47 0.38
48 0.43
49 0.45
50 0.48
51 0.53
52 0.51
53 0.45
54 0.39
55 0.32
56 0.26
57 0.21
58 0.15
59 0.11
60 0.11
61 0.11
62 0.11
63 0.12
64 0.11
65 0.1
66 0.1
67 0.1
68 0.1
69 0.09
70 0.09
71 0.09
72 0.08
73 0.1
74 0.11
75 0.11
76 0.18
77 0.23
78 0.32
79 0.41
80 0.5
81 0.59
82 0.69
83 0.77
84 0.8
85 0.86
86 0.88
87 0.9
88 0.92
89 0.88
90 0.88
91 0.88
92 0.84
93 0.83
94 0.82
95 0.79
96 0.73
97 0.71
98 0.68
99 0.6
100 0.55
101 0.49
102 0.44
103 0.36
104 0.33
105 0.3
106 0.23
107 0.25
108 0.23
109 0.22
110 0.19
111 0.19
112 0.19
113 0.19
114 0.19
115 0.21
116 0.22
117 0.25
118 0.24
119 0.28
120 0.28
121 0.31
122 0.29
123 0.3
124 0.38
125 0.41
126 0.42
127 0.42
128 0.5
129 0.49
130 0.51
131 0.5
132 0.45
133 0.46
134 0.51
135 0.54
136 0.54