Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BGJ5

Protein Details
Accession A0A1Y2BGJ5   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
34-67KRLLLHCKKICSNKNNNRKLKKFCKKCLPLDILHHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 6, mito 5, nucl 4.5, cyto_nucl 3.5, pero 3, E.R. 3, plas 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001087  GDSL  
IPR036514  SGNH_hydro_sf  
Gene Ontology GO:0016788  F:hydrolase activity, acting on ester bonds  
Pfam View protein in Pfam  
PF00657  Lipase_GDSL  
Amino Acid Sequences MNINNKYSLFTILVFTILFLKLNYASTRNISKNKRLLLHCKKICSNKNNNRKLKKFCKKCLPLDILHKNKSPENNKIFENNENFENNKISYYNILFENKNSSIIHLSNSTKFDYHKIENLIVFGDSNSSVGTNYTDMTYTGMNHSGGKNWPLYLKDFNKMKLWNYATPRAPIYEKLFNDSRDLKTQCDYFYENMSKGKKFYNTWNENNSIFAFWFGTIDIGFRNHNYKTVEELAKNFFNLIERMYDYGLRNILILGAPPLYRIPSHRSFTKCRDISDENCIKFLKNEVLTFNNEIMAKSNIFFNKHKDINLIYCSTVDIFENIISNCNKYKFKDCINTWRSNKKNNVNDYFWANSHLSDLANKILARDINELLSSLNKSTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.12
5 0.12
6 0.1
7 0.12
8 0.12
9 0.16
10 0.18
11 0.18
12 0.21
13 0.25
14 0.33
15 0.38
16 0.46
17 0.5
18 0.57
19 0.62
20 0.67
21 0.7
22 0.69
23 0.73
24 0.75
25 0.78
26 0.74
27 0.74
28 0.75
29 0.77
30 0.79
31 0.78
32 0.79
33 0.78
34 0.84
35 0.87
36 0.9
37 0.9
38 0.89
39 0.9
40 0.9
41 0.9
42 0.9
43 0.89
44 0.9
45 0.89
46 0.88
47 0.88
48 0.82
49 0.78
50 0.78
51 0.78
52 0.75
53 0.71
54 0.67
55 0.6
56 0.58
57 0.61
58 0.57
59 0.57
60 0.55
61 0.54
62 0.52
63 0.55
64 0.53
65 0.51
66 0.5
67 0.42
68 0.38
69 0.37
70 0.36
71 0.32
72 0.31
73 0.24
74 0.21
75 0.18
76 0.16
77 0.17
78 0.18
79 0.18
80 0.19
81 0.22
82 0.21
83 0.21
84 0.27
85 0.24
86 0.26
87 0.23
88 0.22
89 0.22
90 0.22
91 0.23
92 0.21
93 0.23
94 0.24
95 0.26
96 0.26
97 0.23
98 0.24
99 0.26
100 0.28
101 0.28
102 0.29
103 0.29
104 0.3
105 0.3
106 0.29
107 0.25
108 0.19
109 0.16
110 0.11
111 0.09
112 0.07
113 0.07
114 0.06
115 0.06
116 0.06
117 0.06
118 0.07
119 0.06
120 0.07
121 0.07
122 0.07
123 0.07
124 0.08
125 0.08
126 0.08
127 0.09
128 0.1
129 0.1
130 0.12
131 0.12
132 0.13
133 0.15
134 0.16
135 0.15
136 0.14
137 0.16
138 0.16
139 0.19
140 0.24
141 0.25
142 0.3
143 0.32
144 0.33
145 0.36
146 0.37
147 0.35
148 0.35
149 0.37
150 0.35
151 0.37
152 0.42
153 0.39
154 0.39
155 0.38
156 0.32
157 0.29
158 0.27
159 0.26
160 0.27
161 0.25
162 0.28
163 0.3
164 0.28
165 0.31
166 0.31
167 0.28
168 0.29
169 0.3
170 0.27
171 0.26
172 0.27
173 0.23
174 0.23
175 0.22
176 0.16
177 0.2
178 0.2
179 0.19
180 0.23
181 0.25
182 0.22
183 0.22
184 0.24
185 0.23
186 0.23
187 0.31
188 0.38
189 0.42
190 0.46
191 0.49
192 0.48
193 0.45
194 0.44
195 0.36
196 0.25
197 0.18
198 0.14
199 0.1
200 0.07
201 0.07
202 0.06
203 0.06
204 0.05
205 0.05
206 0.05
207 0.06
208 0.07
209 0.07
210 0.11
211 0.11
212 0.15
213 0.17
214 0.17
215 0.2
216 0.25
217 0.28
218 0.25
219 0.28
220 0.28
221 0.27
222 0.26
223 0.22
224 0.16
225 0.15
226 0.14
227 0.12
228 0.1
229 0.1
230 0.11
231 0.12
232 0.15
233 0.14
234 0.16
235 0.16
236 0.14
237 0.13
238 0.12
239 0.12
240 0.08
241 0.07
242 0.06
243 0.07
244 0.06
245 0.07
246 0.08
247 0.08
248 0.09
249 0.12
250 0.18
251 0.24
252 0.28
253 0.34
254 0.4
255 0.46
256 0.52
257 0.6
258 0.55
259 0.5
260 0.53
261 0.52
262 0.49
263 0.52
264 0.53
265 0.43
266 0.43
267 0.42
268 0.35
269 0.3
270 0.3
271 0.27
272 0.23
273 0.24
274 0.25
275 0.28
276 0.31
277 0.32
278 0.29
279 0.25
280 0.22
281 0.2
282 0.2
283 0.19
284 0.16
285 0.14
286 0.19
287 0.19
288 0.24
289 0.26
290 0.3
291 0.36
292 0.38
293 0.39
294 0.37
295 0.38
296 0.38
297 0.4
298 0.36
299 0.27
300 0.25
301 0.25
302 0.22
303 0.19
304 0.14
305 0.11
306 0.1
307 0.1
308 0.12
309 0.12
310 0.16
311 0.16
312 0.18
313 0.22
314 0.27
315 0.3
316 0.32
317 0.4
318 0.41
319 0.5
320 0.57
321 0.59
322 0.64
323 0.68
324 0.74
325 0.73
326 0.77
327 0.75
328 0.75
329 0.79
330 0.78
331 0.79
332 0.79
333 0.79
334 0.73
335 0.7
336 0.66
337 0.59
338 0.5
339 0.45
340 0.36
341 0.28
342 0.26
343 0.24
344 0.19
345 0.17
346 0.18
347 0.16
348 0.19
349 0.19
350 0.18
351 0.22
352 0.23
353 0.24
354 0.27
355 0.26
356 0.24
357 0.24
358 0.24
359 0.2
360 0.22
361 0.2