Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2EZ35

Protein Details
Accession A0A1Y2EZ35    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
56-80CHEKIFKNGKKGKKNEAKKILQLYFHydrophilic
NLS Segment(s)
PositionSequence
63-73NGKKGKKNEAK
Subcellular Location(s) mito 11, cyto 11, cyto_mito 11
Family & Domain DBs
Amino Acid Sequences MTINKEISIHLKNNPAINLKNNNITKNIDISFYLTENGILIFEIVNKGEKYYFEICHEKIFKNGKKGKKNEAKKILQLYFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.37
4 0.41
5 0.43
6 0.39
7 0.45
8 0.45
9 0.43
10 0.41
11 0.4
12 0.35
13 0.32
14 0.3
15 0.22
16 0.19
17 0.19
18 0.17
19 0.15
20 0.14
21 0.1
22 0.09
23 0.08
24 0.08
25 0.05
26 0.04
27 0.04
28 0.03
29 0.03
30 0.04
31 0.04
32 0.06
33 0.06
34 0.07
35 0.08
36 0.08
37 0.13
38 0.16
39 0.18
40 0.21
41 0.26
42 0.26
43 0.33
44 0.36
45 0.31
46 0.35
47 0.43
48 0.43
49 0.49
50 0.57
51 0.59
52 0.66
53 0.72
54 0.76
55 0.76
56 0.82
57 0.82
58 0.85
59 0.82
60 0.8
61 0.83