Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2CA34

Protein Details
Accession A0A1Y2CA34    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-36EFYEMYQNKKTRKNKNKTKTKTIPTLTPHydrophilic
NLS Segment(s)
PositionSequence
20-24RKNKN
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 6
Family & Domain DBs
Amino Acid Sequences MSCKEDKLEFYEMYQNKKTRKNKNKTKTKTIPTLTPKTSYSEYSFKGVIGNKYYLGVPDLSTISKIEILNSSDNPYYTWIFDSTSSPSFMYLVNSKNGKQGKKSNYCLDINDPYIFIVNCANTKHKFKYGGEEYSSVFIMFIVVTNTKICKRKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.49
4 0.58
5 0.65
6 0.67
7 0.75
8 0.79
9 0.82
10 0.88
11 0.92
12 0.91
13 0.92
14 0.91
15 0.88
16 0.87
17 0.8
18 0.78
19 0.76
20 0.75
21 0.66
22 0.6
23 0.53
24 0.47
25 0.45
26 0.39
27 0.36
28 0.32
29 0.32
30 0.31
31 0.3
32 0.25
33 0.27
34 0.26
35 0.25
36 0.23
37 0.22
38 0.2
39 0.2
40 0.2
41 0.17
42 0.14
43 0.12
44 0.08
45 0.09
46 0.1
47 0.09
48 0.09
49 0.09
50 0.08
51 0.11
52 0.1
53 0.1
54 0.11
55 0.13
56 0.14
57 0.14
58 0.16
59 0.14
60 0.14
61 0.14
62 0.14
63 0.12
64 0.11
65 0.11
66 0.09
67 0.1
68 0.11
69 0.12
70 0.12
71 0.13
72 0.14
73 0.13
74 0.12
75 0.12
76 0.11
77 0.12
78 0.13
79 0.13
80 0.16
81 0.18
82 0.19
83 0.24
84 0.29
85 0.29
86 0.32
87 0.39
88 0.45
89 0.53
90 0.58
91 0.58
92 0.58
93 0.58
94 0.54
95 0.51
96 0.45
97 0.38
98 0.33
99 0.27
100 0.21
101 0.21
102 0.19
103 0.14
104 0.12
105 0.11
106 0.13
107 0.15
108 0.2
109 0.22
110 0.29
111 0.33
112 0.36
113 0.41
114 0.41
115 0.48
116 0.5
117 0.52
118 0.49
119 0.47
120 0.42
121 0.38
122 0.37
123 0.27
124 0.2
125 0.13
126 0.1
127 0.08
128 0.07
129 0.08
130 0.09
131 0.1
132 0.12
133 0.16
134 0.23