Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2B157

Protein Details
Accession A0A1Y2B157    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-37AAAKAGGKAKKKKWSKGKVKDKANNAVTHydrophilic
NLS Segment(s)
PositionSequence
6-31AAKAAAAKAGGKAKKKKWSKGKVKDK
Subcellular Location(s) nucl 17, mito 7, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPDKAAKAAAAKAGGKAKKKKWSKGKVKDKANNAVTFNQETYDRLFKEVPTYKLITPSQLVDRLKINASLARAALKELEHKGLIRLISSHKSQLIYTRATLEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.41
4 0.47
5 0.52
6 0.58
7 0.67
8 0.72
9 0.76
10 0.81
11 0.84
12 0.86
13 0.9
14 0.89
15 0.91
16 0.88
17 0.85
18 0.83
19 0.77
20 0.7
21 0.62
22 0.55
23 0.47
24 0.41
25 0.34
26 0.25
27 0.2
28 0.17
29 0.17
30 0.19
31 0.16
32 0.17
33 0.17
34 0.16
35 0.24
36 0.28
37 0.26
38 0.25
39 0.27
40 0.25
41 0.3
42 0.3
43 0.24
44 0.2
45 0.2
46 0.19
47 0.22
48 0.22
49 0.18
50 0.2
51 0.2
52 0.2
53 0.19
54 0.18
55 0.14
56 0.15
57 0.15
58 0.14
59 0.14
60 0.13
61 0.13
62 0.13
63 0.12
64 0.15
65 0.16
66 0.19
67 0.18
68 0.18
69 0.19
70 0.21
71 0.2
72 0.16
73 0.16
74 0.19
75 0.22
76 0.24
77 0.26
78 0.26
79 0.28
80 0.28
81 0.33
82 0.33
83 0.31
84 0.3