Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2ELV5

Protein Details
Accession A0A1Y2ELV5    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
164-187EEESQMKQKKKNEFKKVKNVLTGRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR040213  GIR2-like  
IPR006575  RWD-domain  
IPR016135  UBQ-conjugating_enzyme/RWD  
IPR032378  ZC3H15/TMA46_C  
Pfam View protein in Pfam  
PF16543  DFRP_C  
PF05773  RWD  
PROSITE View protein in PROSITE  
PS50908  RWD  
Amino Acid Sequences QELEALEAIYFDEFEKLNEEPPSFRISIKSEDPYEDYEEVEDHGIISLYFYIEYPETYPEVKPIMEIQEAENLDENDINKLLEELDQTAEENIGLGMVFTLSSQLKETIDNLVIERKEQREREEEERIKREEEEERKKHEGTKVTVESFLDWKAKFDKEMKELEEESQMKQKKKNEFKKVKNVLTGRQLFEQDTTLLDSDKAFAEEGDVEVDLALFEDEMDNLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.12
3 0.12
4 0.16
5 0.19
6 0.2
7 0.2
8 0.22
9 0.27
10 0.25
11 0.25
12 0.25
13 0.25
14 0.3
15 0.33
16 0.36
17 0.33
18 0.35
19 0.36
20 0.35
21 0.36
22 0.31
23 0.26
24 0.22
25 0.2
26 0.18
27 0.16
28 0.13
29 0.08
30 0.07
31 0.07
32 0.06
33 0.06
34 0.06
35 0.05
36 0.05
37 0.05
38 0.07
39 0.07
40 0.08
41 0.09
42 0.1
43 0.11
44 0.13
45 0.13
46 0.13
47 0.14
48 0.14
49 0.13
50 0.13
51 0.15
52 0.15
53 0.15
54 0.14
55 0.19
56 0.19
57 0.19
58 0.19
59 0.16
60 0.15
61 0.16
62 0.15
63 0.1
64 0.1
65 0.09
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.08
74 0.08
75 0.08
76 0.07
77 0.06
78 0.06
79 0.04
80 0.03
81 0.03
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.04
88 0.04
89 0.05
90 0.06
91 0.07
92 0.08
93 0.08
94 0.09
95 0.09
96 0.1
97 0.1
98 0.09
99 0.12
100 0.12
101 0.12
102 0.14
103 0.15
104 0.2
105 0.21
106 0.24
107 0.26
108 0.31
109 0.36
110 0.43
111 0.46
112 0.47
113 0.5
114 0.48
115 0.44
116 0.39
117 0.36
118 0.35
119 0.39
120 0.43
121 0.43
122 0.48
123 0.51
124 0.51
125 0.53
126 0.5
127 0.47
128 0.4
129 0.44
130 0.41
131 0.38
132 0.39
133 0.35
134 0.31
135 0.26
136 0.24
137 0.19
138 0.16
139 0.16
140 0.19
141 0.2
142 0.22
143 0.26
144 0.29
145 0.3
146 0.34
147 0.34
148 0.35
149 0.35
150 0.33
151 0.35
152 0.31
153 0.28
154 0.32
155 0.36
156 0.36
157 0.4
158 0.46
159 0.49
160 0.59
161 0.67
162 0.71
163 0.76
164 0.82
165 0.87
166 0.91
167 0.85
168 0.83
169 0.77
170 0.72
171 0.71
172 0.66
173 0.58
174 0.51
175 0.47
176 0.39
177 0.37
178 0.32
179 0.22
180 0.18
181 0.18
182 0.15
183 0.14
184 0.13
185 0.12
186 0.11
187 0.12
188 0.12
189 0.1
190 0.09
191 0.1
192 0.11
193 0.11
194 0.11
195 0.1
196 0.09
197 0.09
198 0.09
199 0.06
200 0.06
201 0.06
202 0.04
203 0.04
204 0.05