Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2ED57

Protein Details
Accession A0A1Y2ED57    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MDKKKKNGINSKKKNNNIDNKKKNNTADNNNKKKNAHydrophilic
NLS Segment(s)
PositionSequence
3-42KKKKNGINSKKKNNNIDNKKKNNTADNNNKKKNAGNGKKK
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023485  Ptyr_pPase  
IPR036196  Ptyr_pPase_sf  
IPR017867  Tyr_phospatase_low_mol_wt  
Gene Ontology GO:0003993  F:acid phosphatase activity  
GO:0004725  F:protein tyrosine phosphatase activity  
GO:0006470  P:protein dephosphorylation  
Pfam View protein in Pfam  
PF01451  LMWPc  
CDD cd16343  LMWPTP  
Amino Acid Sequences MDKKKKNGINSKKKNNNIDNKKKNNTADNNNKKKNAGNGKKKIGVLFVCLGNICRSPMAEAVFIHEVTQRQLQDKFIIDSCGTGGKGFHIGKKPDSRTLSVCKNNKVKINHGARRILNEDFDNFDYILGMDYKNLENLTKMAPENSRAKVQLFGEYDPEDEIEIRDPYFSKGINAFEHTFEQVTRCSLGLLDHLGFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.89
4 0.89
5 0.9
6 0.89
7 0.89
8 0.88
9 0.85
10 0.81
11 0.8
12 0.77
13 0.77
14 0.77
15 0.79
16 0.82
17 0.82
18 0.79
19 0.71
20 0.66
21 0.65
22 0.65
23 0.64
24 0.65
25 0.67
26 0.71
27 0.74
28 0.72
29 0.63
30 0.57
31 0.47
32 0.4
33 0.34
34 0.27
35 0.22
36 0.2
37 0.2
38 0.16
39 0.16
40 0.13
41 0.1
42 0.1
43 0.11
44 0.13
45 0.14
46 0.14
47 0.13
48 0.16
49 0.17
50 0.16
51 0.15
52 0.15
53 0.14
54 0.14
55 0.18
56 0.15
57 0.17
58 0.18
59 0.19
60 0.19
61 0.2
62 0.2
63 0.17
64 0.18
65 0.15
66 0.14
67 0.13
68 0.12
69 0.11
70 0.09
71 0.08
72 0.07
73 0.13
74 0.13
75 0.16
76 0.2
77 0.22
78 0.27
79 0.34
80 0.36
81 0.37
82 0.39
83 0.38
84 0.35
85 0.39
86 0.42
87 0.43
88 0.44
89 0.44
90 0.48
91 0.49
92 0.52
93 0.5
94 0.47
95 0.48
96 0.55
97 0.53
98 0.52
99 0.54
100 0.48
101 0.49
102 0.47
103 0.38
104 0.3
105 0.26
106 0.22
107 0.19
108 0.19
109 0.17
110 0.14
111 0.13
112 0.11
113 0.1
114 0.1
115 0.07
116 0.06
117 0.05
118 0.07
119 0.07
120 0.09
121 0.09
122 0.08
123 0.09
124 0.1
125 0.11
126 0.13
127 0.13
128 0.15
129 0.16
130 0.2
131 0.25
132 0.26
133 0.28
134 0.27
135 0.27
136 0.29
137 0.29
138 0.31
139 0.28
140 0.26
141 0.26
142 0.26
143 0.25
144 0.21
145 0.2
146 0.14
147 0.12
148 0.12
149 0.11
150 0.11
151 0.11
152 0.12
153 0.12
154 0.14
155 0.17
156 0.16
157 0.16
158 0.18
159 0.22
160 0.24
161 0.28
162 0.27
163 0.27
164 0.29
165 0.28
166 0.25
167 0.23
168 0.22
169 0.18
170 0.18
171 0.17
172 0.15
173 0.14
174 0.13
175 0.14
176 0.15
177 0.17