Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CDA1

Protein Details
Accession A0A1Y2CDA1   
Localization Confidence High
Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-57EASPTSPSKRNRKREAEEIDHydrophilic
85-120KPNYNKYKKRGGKKAGKSRVSKKCNEQKRKDILKNVBasic
NLS Segment(s)
PositionSequence
46-51KRNRKR
88-107YNKYKKRGGKKAGKSRVSKK
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
Amino Acid Sequences MPYNTRLRGKNQPFSAGETDKKEVLASPTKKAKLSNSEASPTSPSKRNRKREAEEIDGELKNARKKVHNEINNLNGAKPSEITPKPNYNKYKKRGGKKAGKSRVSKKCNEQKRKDILKNVDTSNIKQLKSVVNSEILSKGLCNTINSLGPEKIMGVLKSSKNEKIESESKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.6
3 0.54
4 0.5
5 0.46
6 0.45
7 0.38
8 0.37
9 0.31
10 0.26
11 0.27
12 0.32
13 0.29
14 0.34
15 0.42
16 0.45
17 0.46
18 0.48
19 0.49
20 0.48
21 0.53
22 0.53
23 0.48
24 0.49
25 0.48
26 0.47
27 0.44
28 0.38
29 0.35
30 0.35
31 0.39
32 0.46
33 0.56
34 0.64
35 0.7
36 0.77
37 0.78
38 0.8
39 0.8
40 0.75
41 0.68
42 0.61
43 0.55
44 0.45
45 0.39
46 0.31
47 0.27
48 0.23
49 0.24
50 0.23
51 0.24
52 0.28
53 0.38
54 0.46
55 0.49
56 0.51
57 0.52
58 0.54
59 0.53
60 0.49
61 0.39
62 0.3
63 0.24
64 0.19
65 0.15
66 0.13
67 0.15
68 0.16
69 0.21
70 0.24
71 0.32
72 0.36
73 0.43
74 0.5
75 0.52
76 0.6
77 0.61
78 0.68
79 0.66
80 0.72
81 0.74
82 0.76
83 0.76
84 0.78
85 0.84
86 0.82
87 0.83
88 0.8
89 0.81
90 0.81
91 0.77
92 0.72
93 0.71
94 0.71
95 0.74
96 0.78
97 0.76
98 0.75
99 0.79
100 0.84
101 0.8
102 0.8
103 0.77
104 0.72
105 0.69
106 0.61
107 0.58
108 0.5
109 0.45
110 0.46
111 0.43
112 0.37
113 0.33
114 0.34
115 0.33
116 0.34
117 0.35
118 0.27
119 0.26
120 0.26
121 0.27
122 0.25
123 0.2
124 0.16
125 0.14
126 0.13
127 0.13
128 0.14
129 0.13
130 0.15
131 0.17
132 0.21
133 0.23
134 0.26
135 0.23
136 0.22
137 0.21
138 0.18
139 0.19
140 0.18
141 0.16
142 0.17
143 0.23
144 0.26
145 0.32
146 0.37
147 0.39
148 0.4
149 0.42
150 0.41
151 0.43