Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AHP4

Protein Details
Accession G3AHP4    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
34-60EKKDYVRRCSLKKHKSKPQPYTFCLGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
KEGG spaa:SPAPADRAFT_59641  -  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MSLFGTKKKESSRRSSVASNSSSSCKESFASFDEKKDYVRRCSLKKHKSKPQPYTFCLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.65
3 0.6
4 0.57
5 0.52
6 0.45
7 0.37
8 0.35
9 0.32
10 0.29
11 0.24
12 0.18
13 0.17
14 0.15
15 0.15
16 0.14
17 0.21
18 0.2
19 0.21
20 0.23
21 0.23
22 0.25
23 0.3
24 0.32
25 0.3
26 0.38
27 0.43
28 0.45
29 0.56
30 0.64
31 0.68
32 0.74
33 0.79
34 0.81
35 0.85
36 0.91
37 0.91
38 0.91
39 0.9
40 0.83