Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2B4E9

Protein Details
Accession A0A1Y2B4E9   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
100-133NSSNNPKLSLRCKKRCSNKNIKLRRLCKKCLLLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Amino Acid Sequences MLNLAYKYNKSSAHYNEYPDQDIMQEYFIENNIEVTLGPNIYNTINTVFYGNNKKVSDEKIIHYIIKKPWNSNEPEYEYINNIWRIYYDEFEELYKLKKNSSNNPKLSLRCKKRCSNKNIKLRRLCKKCLLLDM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.51
4 0.51
5 0.5
6 0.42
7 0.36
8 0.27
9 0.26
10 0.21
11 0.16
12 0.12
13 0.1
14 0.1
15 0.1
16 0.1
17 0.09
18 0.09
19 0.08
20 0.07
21 0.07
22 0.08
23 0.08
24 0.07
25 0.07
26 0.07
27 0.08
28 0.08
29 0.08
30 0.08
31 0.09
32 0.09
33 0.09
34 0.1
35 0.09
36 0.14
37 0.21
38 0.21
39 0.25
40 0.25
41 0.26
42 0.27
43 0.3
44 0.32
45 0.28
46 0.28
47 0.28
48 0.29
49 0.28
50 0.27
51 0.28
52 0.26
53 0.31
54 0.3
55 0.27
56 0.31
57 0.34
58 0.38
59 0.36
60 0.37
61 0.34
62 0.35
63 0.35
64 0.31
65 0.28
66 0.25
67 0.25
68 0.22
69 0.17
70 0.14
71 0.13
72 0.16
73 0.16
74 0.16
75 0.14
76 0.14
77 0.15
78 0.15
79 0.16
80 0.13
81 0.14
82 0.18
83 0.16
84 0.19
85 0.23
86 0.29
87 0.38
88 0.49
89 0.57
90 0.55
91 0.62
92 0.64
93 0.66
94 0.7
95 0.7
96 0.7
97 0.7
98 0.74
99 0.77
100 0.82
101 0.86
102 0.86
103 0.87
104 0.86
105 0.87
106 0.9
107 0.9
108 0.9
109 0.9
110 0.9
111 0.87
112 0.85
113 0.84
114 0.82