Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FHJ5

Protein Details
Accession A0A1Y2FHJ5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-28YSKARFLGYKRSKHNQRLHTSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MDELMILYSKARFLGYKRSKHNQRLHTSLLEIENVNTTKDSLFYLGKRVAYVYRATKEVNGSKVRVIWGRITATHGNSGVVKAKFRKNLPPRAIGAQVRVMMYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.34
3 0.42
4 0.49
5 0.59
6 0.68
7 0.76
8 0.83
9 0.81
10 0.79
11 0.77
12 0.73
13 0.64
14 0.55
15 0.48
16 0.4
17 0.31
18 0.24
19 0.18
20 0.17
21 0.16
22 0.15
23 0.12
24 0.11
25 0.1
26 0.1
27 0.1
28 0.09
29 0.11
30 0.11
31 0.15
32 0.16
33 0.17
34 0.16
35 0.16
36 0.15
37 0.14
38 0.17
39 0.17
40 0.16
41 0.17
42 0.18
43 0.18
44 0.22
45 0.23
46 0.26
47 0.24
48 0.24
49 0.23
50 0.24
51 0.25
52 0.22
53 0.21
54 0.17
55 0.18
56 0.19
57 0.18
58 0.22
59 0.23
60 0.22
61 0.23
62 0.21
63 0.19
64 0.18
65 0.19
66 0.2
67 0.19
68 0.22
69 0.25
70 0.31
71 0.37
72 0.4
73 0.5
74 0.52
75 0.62
76 0.64
77 0.65
78 0.62
79 0.6
80 0.64
81 0.55
82 0.49
83 0.44
84 0.4
85 0.35
86 0.31
87 0.27