Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EPW3

Protein Details
Accession A0A1Y2EPW3   
Localization Confidence High
Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-59LLTNRKKDKTINNRKRISKKKSDPIIKKKLRKEATHydrophilic
142-167SDVNDEKQERNKNKEKKKRKKRQRRYBasic
NLS Segment(s)
PositionSequence
29-61RKKDKTINNRKRISKKKSDPIIKKKLRKEATLK
151-167RNKNKEKKKRKKRQRRY
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MTKKSSKRKNLEVEELREEEEKELLLTNRKKDKTINNRKRISKKKSDPIIKKKLRKEATLKETELNKKSKANIDSHCNRKNKILKNKKEEEDEKVKDEYNESKDSDEENEDEKVKDEYNESKDSDEENEDESEQDDEELKESDVNDEKQERNKNKEKKKRKKRQRRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.67
3 0.59
4 0.5
5 0.42
6 0.33
7 0.25
8 0.19
9 0.13
10 0.15
11 0.15
12 0.22
13 0.26
14 0.33
15 0.42
16 0.44
17 0.45
18 0.49
19 0.58
20 0.6
21 0.67
22 0.7
23 0.71
24 0.78
25 0.85
26 0.89
27 0.89
28 0.87
29 0.86
30 0.85
31 0.85
32 0.86
33 0.87
34 0.87
35 0.87
36 0.89
37 0.87
38 0.86
39 0.83
40 0.83
41 0.77
42 0.74
43 0.72
44 0.71
45 0.7
46 0.67
47 0.61
48 0.56
49 0.57
50 0.57
51 0.53
52 0.47
53 0.41
54 0.37
55 0.39
56 0.41
57 0.38
58 0.37
59 0.36
60 0.41
61 0.46
62 0.52
63 0.56
64 0.52
65 0.5
66 0.52
67 0.56
68 0.57
69 0.61
70 0.63
71 0.65
72 0.71
73 0.77
74 0.72
75 0.71
76 0.64
77 0.6
78 0.58
79 0.52
80 0.46
81 0.4
82 0.37
83 0.3
84 0.3
85 0.29
86 0.24
87 0.25
88 0.22
89 0.22
90 0.22
91 0.23
92 0.22
93 0.18
94 0.15
95 0.14
96 0.15
97 0.16
98 0.15
99 0.15
100 0.15
101 0.14
102 0.13
103 0.14
104 0.17
105 0.21
106 0.23
107 0.23
108 0.22
109 0.22
110 0.23
111 0.22
112 0.18
113 0.15
114 0.14
115 0.15
116 0.14
117 0.14
118 0.14
119 0.12
120 0.11
121 0.1
122 0.09
123 0.09
124 0.1
125 0.11
126 0.1
127 0.11
128 0.11
129 0.15
130 0.19
131 0.2
132 0.24
133 0.28
134 0.31
135 0.38
136 0.48
137 0.51
138 0.56
139 0.65
140 0.71
141 0.77
142 0.84
143 0.87
144 0.89
145 0.93
146 0.94
147 0.96