Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2DKT8

Protein Details
Accession A0A1Y2DKT8    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
34-62ASKKLNKKLLKTVRKEKKKDNKVENVIYNHydrophilic
NLS Segment(s)
PositionSequence
34-53ASKKLNKKLLKTVRKEKKKD
69-90KSSKAKDIKRGVKEVVKGLRKG
Subcellular Location(s) nucl 21.5, mito_nucl 11.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
IPR004037  Ribosomal_L7Ae_CS  
IPR000948  Ribosomal_L7Ae_prok  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006364  P:rRNA processing  
GO:0006412  P:translation  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
PROSITE View protein in PROSITE  
PS01082  RIBOSOMAL_L7AE  
Amino Acid Sequences MGKDGKVKKEKKSDSEDNYESRLSALNEISKPLASKKLNKKLLKTVRKEKKKDNKVENVIYNLLLDFKKSSKAKDIKRGVKEVVKGLRKGNKGLVIIAGDISPIDVITHVPILCEESDVPYCYVPSKEDLGTAGSTKRPTSCVMIVKNKDAEYKDLYEECVSEVKEMEVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.74
4 0.66
5 0.61
6 0.53
7 0.43
8 0.34
9 0.3
10 0.22
11 0.2
12 0.19
13 0.22
14 0.22
15 0.23
16 0.24
17 0.21
18 0.21
19 0.21
20 0.27
21 0.26
22 0.35
23 0.44
24 0.54
25 0.63
26 0.66
27 0.69
28 0.71
29 0.77
30 0.78
31 0.76
32 0.76
33 0.77
34 0.83
35 0.84
36 0.84
37 0.85
38 0.85
39 0.86
40 0.85
41 0.84
42 0.81
43 0.81
44 0.73
45 0.65
46 0.55
47 0.45
48 0.36
49 0.25
50 0.2
51 0.14
52 0.11
53 0.09
54 0.09
55 0.16
56 0.17
57 0.19
58 0.26
59 0.35
60 0.4
61 0.49
62 0.58
63 0.59
64 0.62
65 0.64
66 0.57
67 0.53
68 0.49
69 0.44
70 0.42
71 0.37
72 0.34
73 0.35
74 0.39
75 0.36
76 0.36
77 0.34
78 0.3
79 0.27
80 0.26
81 0.23
82 0.16
83 0.15
84 0.13
85 0.1
86 0.06
87 0.05
88 0.05
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.04
95 0.06
96 0.06
97 0.06
98 0.06
99 0.08
100 0.08
101 0.09
102 0.08
103 0.09
104 0.11
105 0.13
106 0.13
107 0.12
108 0.12
109 0.13
110 0.14
111 0.12
112 0.13
113 0.15
114 0.14
115 0.15
116 0.15
117 0.16
118 0.16
119 0.16
120 0.15
121 0.16
122 0.17
123 0.18
124 0.18
125 0.18
126 0.2
127 0.24
128 0.28
129 0.32
130 0.38
131 0.47
132 0.49
133 0.52
134 0.54
135 0.5
136 0.5
137 0.44
138 0.41
139 0.36
140 0.36
141 0.35
142 0.32
143 0.33
144 0.29
145 0.27
146 0.24
147 0.23
148 0.21
149 0.17
150 0.17
151 0.15