Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EVL9

Protein Details
Accession H0EVL9   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-42ILNVLAQRRYRQRKRERLQSLEKRLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
IPR020844  Circadian_clock_KaiA_N  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0007623  P:circadian rhythm  
PROSITE View protein in PROSITE  
PS51430  KAIA_N  
Amino Acid Sequences MSSQEVPIPNGPERQRILNVLAQRRYRQRKRERLQSLEKRLDARLGSANTVYPSGRKVQLNHPIQTPLSVPSNPAATIDALQHSTKRPVNVKFHIPSRTSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.36
4 0.37
5 0.34
6 0.39
7 0.4
8 0.45
9 0.44
10 0.48
11 0.55
12 0.62
13 0.67
14 0.7
15 0.73
16 0.78
17 0.82
18 0.87
19 0.86
20 0.84
21 0.86
22 0.85
23 0.83
24 0.78
25 0.71
26 0.63
27 0.54
28 0.48
29 0.37
30 0.29
31 0.24
32 0.19
33 0.18
34 0.16
35 0.16
36 0.13
37 0.14
38 0.12
39 0.08
40 0.08
41 0.1
42 0.14
43 0.15
44 0.18
45 0.25
46 0.34
47 0.39
48 0.4
49 0.38
50 0.37
51 0.35
52 0.33
53 0.26
54 0.19
55 0.18
56 0.16
57 0.15
58 0.14
59 0.16
60 0.15
61 0.15
62 0.13
63 0.11
64 0.11
65 0.12
66 0.12
67 0.13
68 0.14
69 0.15
70 0.17
71 0.23
72 0.25
73 0.31
74 0.36
75 0.42
76 0.5
77 0.54
78 0.6
79 0.6
80 0.63
81 0.64
82 0.59