Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2ETA3

Protein Details
Accession A0A1Y2ETA3    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-26VSTKVEKKKKEGGRKITCYNCHydrophilic
NLS Segment(s)
PositionSequence
12-17KKKKEG
Subcellular Location(s) nucl 16, mito 10, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039355  Transcription_factor_GATA  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS50114  GATA_ZN_FINGER_2  
CDD cd00202  ZnF_GATA  
Amino Acid Sequences MIVPEVSTKVEKKKKEGGRKITCYNCHTDTTPLWRRTPDRLHSLCNACGLYYKQYKTHRPLNLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.68
3 0.75
4 0.75
5 0.78
6 0.81
7 0.82
8 0.8
9 0.76
10 0.68
11 0.63
12 0.55
13 0.47
14 0.41
15 0.36
16 0.3
17 0.33
18 0.39
19 0.36
20 0.34
21 0.35
22 0.36
23 0.41
24 0.47
25 0.43
26 0.44
27 0.43
28 0.46
29 0.49
30 0.5
31 0.44
32 0.39
33 0.34
34 0.25
35 0.26
36 0.24
37 0.25
38 0.28
39 0.3
40 0.35
41 0.43
42 0.52
43 0.56
44 0.63