Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DXB4

Protein Details
Accession A0A1Y2DXB4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
249-271GSLYKFNRRNNEKLKEKKRPDIIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 24, pero 1, E.R. 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000620  EamA_dom  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00892  EamA  
Amino Acid Sequences METNNLKVEISINENFTEKEITDLNLNKLEDEEVIKEQKTTPVKDSRLRKICVNRFWLYVLAIVCTFLWGSAFPSIKLGYEEFHINSQDLKSIFLFAGMRFTFAGLIIIVAYCIIKRRFIKPKLREIPDIITLGFIGITLQYIIFYYGLSNSTGVKCSIINSCNTFFTVILAHFLFKNDRITIRKFIGCVIGFIGVIIINVGFDFLRSNKDESKKFEWSFTIKGEGAIMISCFLSSCASVVIKILTAKGSLYKFNRRNNEKLKEKKRPDIIMITGYQMFLGALIIDIIAIVWMIITPLEPPEGSTEKPYRNVSFKGYLLMIHMSLLSAVAFSIWNTLIRFNDVGKIAYFNFLIPIFGSFLSGIFLGEELFKIENLIALVLVCIGVIIVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.24
4 0.24
5 0.17
6 0.17
7 0.16
8 0.17
9 0.22
10 0.26
11 0.28
12 0.31
13 0.31
14 0.28
15 0.28
16 0.27
17 0.22
18 0.21
19 0.2
20 0.19
21 0.23
22 0.23
23 0.23
24 0.24
25 0.3
26 0.34
27 0.35
28 0.38
29 0.44
30 0.5
31 0.57
32 0.64
33 0.67
34 0.7
35 0.68
36 0.69
37 0.71
38 0.73
39 0.73
40 0.72
41 0.64
42 0.57
43 0.56
44 0.49
45 0.39
46 0.33
47 0.25
48 0.19
49 0.16
50 0.15
51 0.13
52 0.11
53 0.1
54 0.07
55 0.07
56 0.06
57 0.08
58 0.13
59 0.14
60 0.13
61 0.16
62 0.16
63 0.17
64 0.18
65 0.17
66 0.12
67 0.14
68 0.17
69 0.16
70 0.18
71 0.18
72 0.16
73 0.18
74 0.17
75 0.19
76 0.16
77 0.16
78 0.14
79 0.15
80 0.14
81 0.14
82 0.15
83 0.11
84 0.18
85 0.16
86 0.17
87 0.15
88 0.16
89 0.14
90 0.12
91 0.13
92 0.06
93 0.06
94 0.05
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.09
101 0.1
102 0.16
103 0.19
104 0.28
105 0.38
106 0.47
107 0.58
108 0.6
109 0.71
110 0.75
111 0.77
112 0.72
113 0.65
114 0.6
115 0.53
116 0.46
117 0.35
118 0.25
119 0.2
120 0.16
121 0.12
122 0.08
123 0.04
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.04
130 0.04
131 0.04
132 0.04
133 0.05
134 0.05
135 0.06
136 0.07
137 0.07
138 0.08
139 0.09
140 0.1
141 0.1
142 0.1
143 0.09
144 0.11
145 0.15
146 0.14
147 0.16
148 0.18
149 0.19
150 0.19
151 0.19
152 0.18
153 0.14
154 0.13
155 0.12
156 0.09
157 0.09
158 0.09
159 0.09
160 0.08
161 0.09
162 0.1
163 0.1
164 0.12
165 0.12
166 0.15
167 0.19
168 0.22
169 0.25
170 0.27
171 0.27
172 0.25
173 0.24
174 0.26
175 0.22
176 0.19
177 0.15
178 0.13
179 0.11
180 0.11
181 0.1
182 0.05
183 0.04
184 0.04
185 0.03
186 0.02
187 0.02
188 0.03
189 0.02
190 0.02
191 0.04
192 0.04
193 0.08
194 0.09
195 0.12
196 0.17
197 0.23
198 0.27
199 0.32
200 0.38
201 0.43
202 0.42
203 0.42
204 0.4
205 0.38
206 0.37
207 0.31
208 0.29
209 0.21
210 0.2
211 0.18
212 0.15
213 0.12
214 0.09
215 0.08
216 0.05
217 0.05
218 0.04
219 0.04
220 0.05
221 0.05
222 0.05
223 0.05
224 0.06
225 0.06
226 0.06
227 0.06
228 0.06
229 0.07
230 0.07
231 0.08
232 0.07
233 0.07
234 0.07
235 0.11
236 0.13
237 0.18
238 0.22
239 0.32
240 0.39
241 0.46
242 0.56
243 0.58
244 0.66
245 0.7
246 0.75
247 0.75
248 0.78
249 0.81
250 0.82
251 0.83
252 0.82
253 0.8
254 0.74
255 0.68
256 0.63
257 0.56
258 0.49
259 0.43
260 0.37
261 0.29
262 0.25
263 0.2
264 0.14
265 0.11
266 0.07
267 0.06
268 0.04
269 0.03
270 0.03
271 0.03
272 0.03
273 0.03
274 0.02
275 0.02
276 0.02
277 0.02
278 0.02
279 0.02
280 0.02
281 0.02
282 0.03
283 0.03
284 0.04
285 0.06
286 0.06
287 0.07
288 0.12
289 0.15
290 0.16
291 0.22
292 0.27
293 0.3
294 0.36
295 0.4
296 0.39
297 0.42
298 0.44
299 0.43
300 0.42
301 0.39
302 0.37
303 0.32
304 0.28
305 0.25
306 0.23
307 0.17
308 0.13
309 0.12
310 0.09
311 0.08
312 0.08
313 0.06
314 0.04
315 0.04
316 0.04
317 0.04
318 0.04
319 0.07
320 0.07
321 0.1
322 0.11
323 0.14
324 0.14
325 0.18
326 0.19
327 0.18
328 0.22
329 0.21
330 0.22
331 0.2
332 0.22
333 0.19
334 0.2
335 0.2
336 0.15
337 0.16
338 0.14
339 0.14
340 0.12
341 0.12
342 0.12
343 0.11
344 0.12
345 0.1
346 0.1
347 0.11
348 0.1
349 0.09
350 0.07
351 0.07
352 0.06
353 0.07
354 0.07
355 0.08
356 0.09
357 0.08
358 0.09
359 0.09
360 0.1
361 0.1
362 0.1
363 0.08
364 0.07
365 0.07
366 0.07
367 0.06
368 0.04
369 0.04