Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2CGU6

Protein Details
Accession A0A1Y2CGU6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKAKRKQVVRKRPVLDTQBasic
NLS Segment(s)
PositionSequence
3-15KRKAKRKQVVRKR
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKAKRKQVVRKRPVLDTQFDCLFCNHEKSITVKMIHETKVGELKCSICGANYQSAINSLSHPIDVYSDWIDACEELNPGAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.81
3 0.79
4 0.72
5 0.68
6 0.6
7 0.55
8 0.49
9 0.45
10 0.39
11 0.31
12 0.29
13 0.24
14 0.24
15 0.19
16 0.17
17 0.18
18 0.19
19 0.24
20 0.24
21 0.24
22 0.2
23 0.23
24 0.25
25 0.25
26 0.23
27 0.18
28 0.16
29 0.2
30 0.19
31 0.17
32 0.15
33 0.15
34 0.15
35 0.15
36 0.14
37 0.09
38 0.11
39 0.12
40 0.15
41 0.15
42 0.14
43 0.13
44 0.15
45 0.16
46 0.14
47 0.13
48 0.12
49 0.11
50 0.11
51 0.11
52 0.1
53 0.1
54 0.1
55 0.12
56 0.12
57 0.12
58 0.11
59 0.12
60 0.12
61 0.11
62 0.11
63 0.09
64 0.08