Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2C2Q4

Protein Details
Accession A0A1Y2C2Q4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
173-204VIRERPTIPRDIKKQKKESMKQSGEKSKLKRKBasic
NLS Segment(s)
PositionSequence
181-204PRDIKKQKKESMKQSGEKSKLKRK
Subcellular Location(s) plas 17, mito 3, E.R. 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012098  SND3_fun  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0045047  P:protein targeting to ER  
Pfam View protein in Pfam  
PF10032  Pho88  
Amino Acid Sequences MGFLNNIKDSVIILLLGVAAIIIDTKNPDVVKWVRIIYYGIHAINLIAILIVHINILVKGQKEKFTYTRITSVLGAAAGEGEVKVISIPIAEYDLIQKNALLRSNLIILVILTITHVLFGWTKPLLLQVYFPLKLLLIHPLFRVHLLQREAKGNLARPWDMYYRIPLSTIGDVIRERPTIPRDIKKQKKESMKQSGEKSKLKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.05
5 0.03
6 0.02
7 0.02
8 0.03
9 0.03
10 0.04
11 0.06
12 0.06
13 0.1
14 0.1
15 0.1
16 0.17
17 0.2
18 0.22
19 0.24
20 0.25
21 0.22
22 0.23
23 0.24
24 0.19
25 0.2
26 0.21
27 0.17
28 0.16
29 0.15
30 0.14
31 0.13
32 0.12
33 0.07
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.04
42 0.04
43 0.05
44 0.07
45 0.08
46 0.13
47 0.15
48 0.2
49 0.22
50 0.27
51 0.29
52 0.32
53 0.36
54 0.34
55 0.36
56 0.31
57 0.31
58 0.26
59 0.24
60 0.19
61 0.14
62 0.11
63 0.07
64 0.06
65 0.04
66 0.04
67 0.03
68 0.03
69 0.02
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.04
79 0.04
80 0.08
81 0.1
82 0.11
83 0.11
84 0.11
85 0.11
86 0.13
87 0.15
88 0.12
89 0.1
90 0.1
91 0.11
92 0.1
93 0.09
94 0.07
95 0.05
96 0.05
97 0.05
98 0.04
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.04
105 0.05
106 0.05
107 0.07
108 0.07
109 0.07
110 0.07
111 0.1
112 0.1
113 0.1
114 0.11
115 0.12
116 0.17
117 0.17
118 0.17
119 0.15
120 0.14
121 0.14
122 0.14
123 0.17
124 0.14
125 0.15
126 0.16
127 0.17
128 0.17
129 0.17
130 0.19
131 0.14
132 0.19
133 0.21
134 0.24
135 0.26
136 0.3
137 0.29
138 0.31
139 0.32
140 0.3
141 0.31
142 0.31
143 0.3
144 0.27
145 0.3
146 0.29
147 0.29
148 0.26
149 0.28
150 0.26
151 0.26
152 0.25
153 0.22
154 0.22
155 0.2
156 0.2
157 0.15
158 0.15
159 0.15
160 0.17
161 0.2
162 0.17
163 0.17
164 0.22
165 0.25
166 0.31
167 0.38
168 0.45
169 0.52
170 0.63
171 0.72
172 0.77
173 0.83
174 0.83
175 0.87
176 0.87
177 0.87
178 0.87
179 0.87
180 0.84
181 0.84
182 0.86
183 0.83
184 0.82