Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2F294

Protein Details
Accession A0A1Y2F294   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
85-121KPNFNKYKKHGSRKVGRKRISKKYNEQKRKNLLKNVDBasic
NLS Segment(s)
PositionSequence
46-51KKSRKR
88-114FNKYKKHGSRKVGRKRISKKYNEQKRK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MPYNTRLRGKNQPFSAGETNKKEVLTSPTKDVKLSKSEASPTSPSKKSRKRGADEIDSELKNMKKKLNSQIENLNGSKPSEITPKPNFNKYKKHGSRKVGRKRISKKYNEQKRKNLLKNVDTSNIKQVRSVINSEILSKGLCNTINSLGPDNIKGVLKSSKNEKTKDESQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.63
3 0.59
4 0.58
5 0.54
6 0.54
7 0.49
8 0.47
9 0.41
10 0.35
11 0.36
12 0.36
13 0.33
14 0.37
15 0.41
16 0.42
17 0.44
18 0.44
19 0.41
20 0.39
21 0.4
22 0.36
23 0.32
24 0.36
25 0.36
26 0.37
27 0.37
28 0.37
29 0.4
30 0.42
31 0.46
32 0.52
33 0.59
34 0.64
35 0.69
36 0.73
37 0.73
38 0.77
39 0.78
40 0.76
41 0.69
42 0.66
43 0.61
44 0.51
45 0.45
46 0.38
47 0.33
48 0.29
49 0.28
50 0.27
51 0.26
52 0.33
53 0.42
54 0.5
55 0.5
56 0.49
57 0.53
58 0.53
59 0.52
60 0.46
61 0.37
62 0.27
63 0.24
64 0.21
65 0.15
66 0.13
67 0.15
68 0.16
69 0.21
70 0.26
71 0.35
72 0.37
73 0.45
74 0.51
75 0.5
76 0.59
77 0.57
78 0.63
79 0.63
80 0.71
81 0.71
82 0.72
83 0.77
84 0.78
85 0.84
86 0.82
87 0.81
88 0.81
89 0.81
90 0.84
91 0.83
92 0.81
93 0.81
94 0.82
95 0.86
96 0.87
97 0.86
98 0.85
99 0.86
100 0.88
101 0.85
102 0.82
103 0.79
104 0.73
105 0.71
106 0.65
107 0.62
108 0.54
109 0.48
110 0.5
111 0.46
112 0.41
113 0.36
114 0.34
115 0.33
116 0.33
117 0.34
118 0.26
119 0.27
120 0.28
121 0.28
122 0.26
123 0.21
124 0.18
125 0.15
126 0.14
127 0.12
128 0.13
129 0.13
130 0.15
131 0.17
132 0.21
133 0.23
134 0.25
135 0.24
136 0.24
137 0.24
138 0.22
139 0.22
140 0.2
141 0.18
142 0.18
143 0.24
144 0.26
145 0.3
146 0.38
147 0.45
148 0.51
149 0.55
150 0.57
151 0.57