Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CH84

Protein Details
Accession A0A1Y2CH84    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-37KNNNNHNNYNNNNKKKKKKKKKTKYITVSLKNQKYHydrophilic
NLS Segment(s)
PositionSequence
16-26KKKKKKKKKTK
Subcellular Location(s) nucl 15, mito_nucl 12.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR009582  Spc2/SPCS2  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF06703  SPC25  
Amino Acid Sequences MCKNNNNHNNYNNNNKKKKKKKKKTKYITVSLKNQKYSDLVEITIKLKDSLRNSTKTLKKSYGNWFDEEGNFVASAFLKDIEYVLEKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.84
4 0.86
5 0.92
6 0.92
7 0.93
8 0.94
9 0.96
10 0.97
11 0.97
12 0.97
13 0.95
14 0.94
15 0.93
16 0.89
17 0.87
18 0.85
19 0.79
20 0.71
21 0.61
22 0.52
23 0.43
24 0.37
25 0.3
26 0.21
27 0.17
28 0.15
29 0.16
30 0.15
31 0.14
32 0.13
33 0.1
34 0.1
35 0.14
36 0.16
37 0.24
38 0.27
39 0.3
40 0.33
41 0.41
42 0.46
43 0.47
44 0.49
45 0.46
46 0.45
47 0.49
48 0.56
49 0.58
50 0.54
51 0.51
52 0.48
53 0.45
54 0.42
55 0.38
56 0.28
57 0.19
58 0.16
59 0.14
60 0.12
61 0.1
62 0.1
63 0.08
64 0.09
65 0.08
66 0.08
67 0.08
68 0.1
69 0.13