Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2BRF5

Protein Details
Accession A0A1Y2BRF5    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-28FFKVEEMKRKIQKNKKDSERNEKISKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, plas 5, mito 3.5, cyto_mito 3, cyto 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences KNFFKVEEMKRKIQKNKKDSERNEKISKMLVDTSIKVAIVSVSISCLWLIYKKISN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.78
3 0.82
4 0.83
5 0.86
6 0.85
7 0.85
8 0.85
9 0.82
10 0.77
11 0.68
12 0.58
13 0.51
14 0.43
15 0.33
16 0.25
17 0.2
18 0.17
19 0.16
20 0.17
21 0.14
22 0.14
23 0.12
24 0.11
25 0.08
26 0.07
27 0.07
28 0.05
29 0.06
30 0.06
31 0.07
32 0.07
33 0.07
34 0.08
35 0.1
36 0.13