Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AGK8

Protein Details
Accession A0A1Y2AGK8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-91PIKFLPVKKVEEKKEKKEKKENBasic
NLS Segment(s)
PositionSequence
77-91KKVEEKKEKKEKKEN
Subcellular Location(s) mito 14, E.R. 6, plas 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009542  Spc1/SPCS1  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF06645  SPC12  
Amino Acid Sequences MALIKDDIDFKGQQLTEKLMQCILIVFGIVSFIVGFVMQSVKISCYIMLAGIIITAVIILPPWPFYSKNPIKFLPVKKVEEKKEKKEKKEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.29
4 0.31
5 0.31
6 0.25
7 0.25
8 0.22
9 0.2
10 0.15
11 0.09
12 0.06
13 0.05
14 0.04
15 0.04
16 0.04
17 0.04
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.04
25 0.04
26 0.04
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.05
35 0.05
36 0.04
37 0.03
38 0.03
39 0.03
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.03
48 0.04
49 0.06
50 0.08
51 0.1
52 0.12
53 0.23
54 0.31
55 0.39
56 0.43
57 0.43
58 0.48
59 0.55
60 0.59
61 0.59
62 0.58
63 0.56
64 0.61
65 0.68
66 0.71
67 0.74
68 0.77
69 0.77
70 0.81
71 0.85