Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2D5Y3

Protein Details
Accession A0A1Y2D5Y3   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
105-126GDKKYDKHLKCKSKKEAKNEIABasic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto 10, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR014720  dsRBD_dom  
Gene Ontology GO:0003723  F:RNA binding  
PROSITE View protein in PROSITE  
PS50137  DS_RBD  
Amino Acid Sequences MSNKNVIENLYEYCQNKNTTISISDLDYIYEINHNGFFNCKVKLNGKYLIKILIGYVKEAEDNRNAIAKLNEYLQDKNTKLNISDLNFEFGITPEGYFNCIVTIGDKKYDKHLKCKSKKEAKNEIAEYVYNSLIRENENKNILNEKVKELLIKNKISLDEINIYDEKGEENKYICLIQCERFKKYNNEGKILFLTPSSKNDLNNKIYKLIEKKISLIKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.31
4 0.31
5 0.29
6 0.27
7 0.27
8 0.26
9 0.23
10 0.22
11 0.22
12 0.19
13 0.17
14 0.14
15 0.13
16 0.11
17 0.12
18 0.1
19 0.1
20 0.12
21 0.12
22 0.12
23 0.15
24 0.18
25 0.18
26 0.2
27 0.22
28 0.24
29 0.3
30 0.35
31 0.38
32 0.42
33 0.43
34 0.43
35 0.42
36 0.4
37 0.34
38 0.28
39 0.24
40 0.22
41 0.18
42 0.16
43 0.16
44 0.13
45 0.15
46 0.16
47 0.17
48 0.15
49 0.15
50 0.15
51 0.18
52 0.18
53 0.18
54 0.18
55 0.17
56 0.15
57 0.16
58 0.19
59 0.18
60 0.19
61 0.2
62 0.25
63 0.24
64 0.27
65 0.28
66 0.25
67 0.23
68 0.26
69 0.27
70 0.23
71 0.27
72 0.24
73 0.23
74 0.22
75 0.22
76 0.18
77 0.14
78 0.14
79 0.1
80 0.09
81 0.07
82 0.07
83 0.09
84 0.09
85 0.08
86 0.06
87 0.06
88 0.06
89 0.07
90 0.1
91 0.09
92 0.13
93 0.14
94 0.15
95 0.23
96 0.32
97 0.32
98 0.39
99 0.48
100 0.55
101 0.62
102 0.71
103 0.74
104 0.76
105 0.8
106 0.8
107 0.81
108 0.76
109 0.75
110 0.67
111 0.58
112 0.48
113 0.42
114 0.34
115 0.24
116 0.19
117 0.12
118 0.11
119 0.1
120 0.09
121 0.11
122 0.15
123 0.16
124 0.19
125 0.23
126 0.24
127 0.24
128 0.28
129 0.28
130 0.29
131 0.28
132 0.26
133 0.25
134 0.24
135 0.26
136 0.24
137 0.31
138 0.31
139 0.31
140 0.3
141 0.29
142 0.29
143 0.29
144 0.28
145 0.22
146 0.2
147 0.19
148 0.22
149 0.19
150 0.19
151 0.16
152 0.16
153 0.14
154 0.12
155 0.13
156 0.12
157 0.13
158 0.14
159 0.15
160 0.17
161 0.16
162 0.19
163 0.21
164 0.25
165 0.33
166 0.37
167 0.41
168 0.46
169 0.51
170 0.54
171 0.61
172 0.64
173 0.61
174 0.62
175 0.57
176 0.55
177 0.53
178 0.46
179 0.36
180 0.28
181 0.27
182 0.23
183 0.26
184 0.29
185 0.27
186 0.31
187 0.39
188 0.46
189 0.49
190 0.53
191 0.52
192 0.5
193 0.5
194 0.53
195 0.52
196 0.51
197 0.51
198 0.46
199 0.49
200 0.54