Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2AI81

Protein Details
Accession A0A1Y2AI81    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
81-104PGSYCFRLRMKKPKDRHWSIDHKDBasic
NLS Segment(s)
Subcellular Location(s) mito 10.5, mito_nucl 10.333, nucl 9, cyto_nucl 7.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036116  FN3_sf  
Amino Acid Sequences MSKIIPKSQAVQQAHKLPTLKYLFPTPDSLKLTWANEDSGFVYQITKYNIANNSLTIDDEDDYTVVYEGDKQFVIMNTIFPGSYCFRLRMKKPKDRHWSIDHKDIIVQIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.49
4 0.39
5 0.44
6 0.42
7 0.36
8 0.3
9 0.34
10 0.32
11 0.33
12 0.38
13 0.32
14 0.35
15 0.37
16 0.35
17 0.33
18 0.34
19 0.33
20 0.29
21 0.28
22 0.22
23 0.18
24 0.19
25 0.16
26 0.14
27 0.13
28 0.1
29 0.1
30 0.08
31 0.11
32 0.12
33 0.12
34 0.12
35 0.16
36 0.17
37 0.19
38 0.19
39 0.16
40 0.16
41 0.14
42 0.14
43 0.1
44 0.09
45 0.07
46 0.07
47 0.07
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.04
54 0.07
55 0.07
56 0.09
57 0.08
58 0.09
59 0.1
60 0.1
61 0.13
62 0.1
63 0.1
64 0.1
65 0.1
66 0.1
67 0.09
68 0.12
69 0.12
70 0.16
71 0.17
72 0.2
73 0.25
74 0.33
75 0.41
76 0.48
77 0.56
78 0.62
79 0.69
80 0.77
81 0.82
82 0.83
83 0.83
84 0.81
85 0.82
86 0.79
87 0.8
88 0.71
89 0.62
90 0.55