Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0ECC9

Protein Details
Accession H0ECC9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MLRNKAILIRKRRSKNPNIISLSYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 6
Family & Domain DBs
Amino Acid Sequences MLRNKAILIRKRRSKNPNIISLSYRDVAHGGVAAEVDADYAGGAVGEGEGDDLVGGGEGGAAVDGEDEGGFHGGVGVGGGDAGEDCADVVCCCDVCGGDGAALQLFACYKLVVAQRKGLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.84
4 0.84
5 0.8
6 0.74
7 0.67
8 0.61
9 0.54
10 0.45
11 0.37
12 0.27
13 0.21
14 0.18
15 0.15
16 0.12
17 0.09
18 0.07
19 0.06
20 0.06
21 0.05
22 0.05
23 0.04
24 0.03
25 0.03
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.03
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06
81 0.06
82 0.07
83 0.09
84 0.08
85 0.08
86 0.08
87 0.09
88 0.08
89 0.08
90 0.07
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.11
98 0.19
99 0.26
100 0.29