Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EYP6

Protein Details
Accession H0EYP6   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
35-56GTTPTPKPKKLKAQSKSPKDIPHydrophilic
NLS Segment(s)
PositionSequence
42-46PKKLK
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040115  Lnp  
IPR019273  Lunapark_dom  
Gene Ontology GO:0098826  C:endoplasmic reticulum tubular network membrane  
GO:0046872  F:metal ion binding  
GO:0071788  P:endoplasmic reticulum tubular network maintenance  
GO:1903373  P:positive regulation of endoplasmic reticulum tubular network organization  
Pfam View protein in Pfam  
PF10058  zinc_ribbon_10  
Amino Acid Sequences MRLEGQQSERTKTIDKLKAATKYNSTQELLEKYGGTTPTPKPKKLKAQSKSPKDIPPQRTVTGPPPPTANIPQRSPDRVSKAPYVSTSEVSPSVGPPNNVRPAPTSPSIGSADIGGHWYDRVLDLLMGEDETSARNRIVLICQNCRLVNGQAPPGIRSATELGRWRCSGCGAWNGEEDEAVKVVQEMKEKIEQQPRHSGSESDEDALSDSHGVPGSEVQKGLDIGSIENVAHVKHKKNGSKDLRKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.47
4 0.52
5 0.56
6 0.58
7 0.57
8 0.53
9 0.52
10 0.55
11 0.54
12 0.49
13 0.42
14 0.42
15 0.41
16 0.37
17 0.32
18 0.26
19 0.22
20 0.25
21 0.24
22 0.2
23 0.22
24 0.25
25 0.35
26 0.41
27 0.46
28 0.49
29 0.58
30 0.67
31 0.72
32 0.77
33 0.73
34 0.78
35 0.83
36 0.85
37 0.85
38 0.8
39 0.77
40 0.76
41 0.79
42 0.74
43 0.72
44 0.67
45 0.6
46 0.56
47 0.52
48 0.48
49 0.48
50 0.43
51 0.36
52 0.33
53 0.33
54 0.34
55 0.38
56 0.39
57 0.35
58 0.35
59 0.4
60 0.42
61 0.45
62 0.45
63 0.45
64 0.44
65 0.43
66 0.45
67 0.45
68 0.43
69 0.4
70 0.37
71 0.37
72 0.31
73 0.29
74 0.24
75 0.2
76 0.18
77 0.17
78 0.16
79 0.11
80 0.14
81 0.15
82 0.15
83 0.16
84 0.22
85 0.26
86 0.26
87 0.26
88 0.25
89 0.27
90 0.3
91 0.29
92 0.26
93 0.21
94 0.24
95 0.24
96 0.21
97 0.18
98 0.13
99 0.12
100 0.09
101 0.1
102 0.07
103 0.05
104 0.05
105 0.05
106 0.04
107 0.04
108 0.05
109 0.04
110 0.04
111 0.04
112 0.05
113 0.05
114 0.04
115 0.04
116 0.04
117 0.03
118 0.04
119 0.05
120 0.06
121 0.06
122 0.06
123 0.06
124 0.07
125 0.1
126 0.16
127 0.19
128 0.22
129 0.25
130 0.27
131 0.26
132 0.27
133 0.26
134 0.21
135 0.21
136 0.2
137 0.2
138 0.2
139 0.2
140 0.2
141 0.19
142 0.18
143 0.13
144 0.13
145 0.13
146 0.12
147 0.16
148 0.22
149 0.24
150 0.27
151 0.28
152 0.27
153 0.25
154 0.25
155 0.23
156 0.19
157 0.23
158 0.22
159 0.23
160 0.24
161 0.24
162 0.22
163 0.21
164 0.19
165 0.12
166 0.1
167 0.09
168 0.07
169 0.06
170 0.09
171 0.11
172 0.14
173 0.15
174 0.18
175 0.24
176 0.26
177 0.33
178 0.4
179 0.42
180 0.43
181 0.52
182 0.52
183 0.51
184 0.51
185 0.45
186 0.39
187 0.42
188 0.38
189 0.29
190 0.26
191 0.21
192 0.21
193 0.2
194 0.16
195 0.1
196 0.09
197 0.09
198 0.1
199 0.1
200 0.09
201 0.14
202 0.16
203 0.16
204 0.16
205 0.15
206 0.16
207 0.17
208 0.16
209 0.14
210 0.12
211 0.11
212 0.13
213 0.13
214 0.11
215 0.12
216 0.12
217 0.1
218 0.17
219 0.22
220 0.25
221 0.32
222 0.42
223 0.48
224 0.56
225 0.66
226 0.7