Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CKL3

Protein Details
Accession A0A1Y2CKL3    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
308-331QQNYSRPHTPHRKKTNSNPYRYDDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR017389  Nucleoporin_NUP53  
IPR013859  Ssr4_N  
IPR046464  SWI-SNF_Ssr4_C  
Gene Ontology GO:0031965  C:nuclear membrane  
GO:0017056  F:structural constituent of nuclear pore  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF20497  SWI-SNF_Ssr4_C  
PF08549  SWI-SNF_Ssr4_N  
Amino Acid Sequences MSNNYQNPQIPIQMQSQHYQNMNPGMGNNIQNLNSPIIQNQKDLQQLNQLNSPHQAIPPQMAQQNYNQPPPMLQPKNTMNRPQPHSKYFFKGTIDYPSFPTFLPIEKFGDLLMSACSVFNKINFEPVYVDKPKEGSIFLILIPKNDENIIDIPSDGYGWMDDENLIKTFSVDNDKKVECYERRLGFAQGQLYCTISRRRFRLRSHNFPMIELLQYVKLHENVPVIPAQIKVQPQNIRLVAGYPPQPQQQPQPQPQPQQQQQQQMQQQQYQMQQQQQHQHQQQQQQQYKQNMNQMNKPMMQQQPQIPPQQNYSRPHTPHRKKTNSNPYRYDDEESGDELDVLQARDISIGRYRRNHDYMSEILSPYNIDSIEPPEIIDINNRENLSNELEKLTKEIEILENDMMENNKKNENFIHSSINKISKCKTEEELQRITNEVNQYLDIQLIPKSEVRKVKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.39
4 0.4
5 0.4
6 0.38
7 0.37
8 0.36
9 0.35
10 0.32
11 0.28
12 0.26
13 0.29
14 0.29
15 0.27
16 0.25
17 0.24
18 0.26
19 0.28
20 0.27
21 0.24
22 0.23
23 0.24
24 0.29
25 0.3
26 0.31
27 0.31
28 0.33
29 0.38
30 0.39
31 0.37
32 0.38
33 0.4
34 0.41
35 0.44
36 0.39
37 0.35
38 0.36
39 0.37
40 0.29
41 0.26
42 0.26
43 0.22
44 0.25
45 0.26
46 0.28
47 0.28
48 0.28
49 0.29
50 0.32
51 0.41
52 0.41
53 0.43
54 0.39
55 0.36
56 0.36
57 0.4
58 0.45
59 0.4
60 0.38
61 0.41
62 0.48
63 0.58
64 0.62
65 0.64
66 0.62
67 0.66
68 0.7
69 0.73
70 0.71
71 0.69
72 0.7
73 0.67
74 0.65
75 0.61
76 0.59
77 0.52
78 0.48
79 0.43
80 0.46
81 0.44
82 0.39
83 0.37
84 0.34
85 0.32
86 0.29
87 0.29
88 0.2
89 0.2
90 0.21
91 0.2
92 0.21
93 0.2
94 0.2
95 0.17
96 0.17
97 0.13
98 0.11
99 0.09
100 0.07
101 0.07
102 0.07
103 0.07
104 0.08
105 0.09
106 0.1
107 0.15
108 0.14
109 0.21
110 0.21
111 0.22
112 0.23
113 0.25
114 0.31
115 0.28
116 0.29
117 0.23
118 0.24
119 0.25
120 0.23
121 0.21
122 0.15
123 0.14
124 0.14
125 0.14
126 0.19
127 0.17
128 0.17
129 0.2
130 0.19
131 0.17
132 0.17
133 0.16
134 0.12
135 0.13
136 0.14
137 0.11
138 0.1
139 0.1
140 0.09
141 0.09
142 0.07
143 0.05
144 0.04
145 0.05
146 0.05
147 0.05
148 0.05
149 0.06
150 0.08
151 0.08
152 0.08
153 0.08
154 0.08
155 0.09
156 0.1
157 0.18
158 0.18
159 0.2
160 0.25
161 0.25
162 0.25
163 0.26
164 0.32
165 0.24
166 0.3
167 0.36
168 0.32
169 0.35
170 0.36
171 0.36
172 0.31
173 0.32
174 0.3
175 0.22
176 0.22
177 0.19
178 0.18
179 0.17
180 0.17
181 0.22
182 0.23
183 0.27
184 0.32
185 0.4
186 0.47
187 0.53
188 0.62
189 0.64
190 0.68
191 0.7
192 0.72
193 0.63
194 0.56
195 0.52
196 0.42
197 0.33
198 0.23
199 0.16
200 0.11
201 0.11
202 0.11
203 0.1
204 0.11
205 0.11
206 0.12
207 0.12
208 0.11
209 0.12
210 0.11
211 0.1
212 0.1
213 0.1
214 0.09
215 0.11
216 0.13
217 0.14
218 0.2
219 0.23
220 0.24
221 0.28
222 0.27
223 0.25
224 0.23
225 0.22
226 0.17
227 0.16
228 0.18
229 0.16
230 0.18
231 0.19
232 0.2
233 0.2
234 0.26
235 0.32
236 0.37
237 0.42
238 0.5
239 0.52
240 0.57
241 0.63
242 0.65
243 0.62
244 0.63
245 0.62
246 0.61
247 0.6
248 0.62
249 0.61
250 0.58
251 0.55
252 0.48
253 0.45
254 0.4
255 0.39
256 0.38
257 0.36
258 0.34
259 0.36
260 0.38
261 0.44
262 0.45
263 0.51
264 0.49
265 0.53
266 0.54
267 0.57
268 0.59
269 0.61
270 0.62
271 0.6
272 0.63
273 0.62
274 0.63
275 0.58
276 0.6
277 0.56
278 0.53
279 0.52
280 0.5
281 0.47
282 0.42
283 0.4
284 0.39
285 0.37
286 0.38
287 0.36
288 0.37
289 0.42
290 0.44
291 0.5
292 0.47
293 0.44
294 0.46
295 0.5
296 0.51
297 0.47
298 0.51
299 0.53
300 0.52
301 0.6
302 0.66
303 0.68
304 0.71
305 0.77
306 0.79
307 0.79
308 0.86
309 0.88
310 0.86
311 0.84
312 0.8
313 0.74
314 0.7
315 0.66
316 0.59
317 0.48
318 0.42
319 0.35
320 0.29
321 0.26
322 0.19
323 0.16
324 0.12
325 0.12
326 0.11
327 0.09
328 0.08
329 0.07
330 0.07
331 0.09
332 0.09
333 0.1
334 0.15
335 0.21
336 0.26
337 0.33
338 0.38
339 0.44
340 0.48
341 0.48
342 0.43
343 0.43
344 0.4
345 0.39
346 0.37
347 0.29
348 0.25
349 0.23
350 0.22
351 0.17
352 0.16
353 0.1
354 0.08
355 0.09
356 0.13
357 0.15
358 0.14
359 0.14
360 0.13
361 0.14
362 0.14
363 0.18
364 0.17
365 0.18
366 0.23
367 0.23
368 0.23
369 0.23
370 0.26
371 0.26
372 0.25
373 0.23
374 0.22
375 0.23
376 0.23
377 0.23
378 0.22
379 0.17
380 0.14
381 0.16
382 0.17
383 0.17
384 0.2
385 0.18
386 0.17
387 0.17
388 0.18
389 0.18
390 0.17
391 0.2
392 0.2
393 0.27
394 0.27
395 0.29
396 0.32
397 0.38
398 0.41
399 0.39
400 0.46
401 0.4
402 0.46
403 0.49
404 0.54
405 0.48
406 0.46
407 0.48
408 0.46
409 0.49
410 0.48
411 0.46
412 0.47
413 0.54
414 0.57
415 0.6
416 0.54
417 0.52
418 0.5
419 0.46
420 0.41
421 0.35
422 0.3
423 0.23
424 0.22
425 0.22
426 0.21
427 0.21
428 0.16
429 0.14
430 0.15
431 0.14
432 0.16
433 0.18
434 0.21
435 0.27