Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BFW4

Protein Details
Accession A0A1Y2BFW4    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MQNTEVKSKRPRKVCDICKSARPHydrophilic
317-339LPSLGIKKSKKARSNPKVVKDGEHydrophilic
NLS Segment(s)
PositionSequence
323-333KKSKKARSNPK
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR032442  CTU1_C  
IPR000541  Ncs6/Tuc1/Ctu1  
IPR014729  Rossmann-like_a/b/a_fold  
IPR011063  TilS/TtcA_N  
IPR020554  UPF0021_CS  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016787  F:hydrolase activity  
GO:0016779  F:nucleotidyltransferase activity  
GO:0000049  F:tRNA binding  
GO:0032447  P:protein urmylation  
GO:0034227  P:tRNA thio-modification  
GO:0002098  P:tRNA wobble uridine modification  
Pfam View protein in Pfam  
PF01171  ATP_bind_3  
PF16503  zn-ribbon_14  
PROSITE View protein in PROSITE  
PS01263  UPF0021  
CDD cd01993  Alpha_ANH_like_II  
Amino Acid Sequences MQNTEVKSKRPRKVCDICKSARPAIKRPKTGQMVCKECFYYVFEEEIHQTIIQGNLFKENERVAIGASGGKDSTVLAYVMNLLNKRHNYKLDLVLLSIDEGITGYRDDSLETVKRNARQYNLPLKIVSYKELYGWSMDEIVKEAGNKNNCTFCGVLRRQALDRGAVMLGSKHILTGHNADDIAETVLMNILRGDVPRLQRCTFITTGNDSMIKRSKPFKYTYEKEIVMYAHYKKLDYFSTECIYAPNAFRGNARVFLKDLEKVRSTAIMDIINSGESYENKSNNNIPSNKICERCGYMSSNKICKACVLLEGLNKGLPSLGIKKSKKARSNPKVVKDGESKEIKVKNFQELTKEENCQMEYEVENPNSGNNSQNEKLVSSVNTMKRKLQNID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.84
4 0.8
5 0.79
6 0.79
7 0.76
8 0.71
9 0.67
10 0.67
11 0.69
12 0.73
13 0.74
14 0.72
15 0.74
16 0.78
17 0.79
18 0.78
19 0.76
20 0.74
21 0.67
22 0.66
23 0.57
24 0.47
25 0.42
26 0.35
27 0.31
28 0.24
29 0.25
30 0.21
31 0.22
32 0.23
33 0.23
34 0.22
35 0.16
36 0.15
37 0.14
38 0.16
39 0.16
40 0.16
41 0.15
42 0.2
43 0.21
44 0.22
45 0.22
46 0.21
47 0.21
48 0.19
49 0.19
50 0.13
51 0.13
52 0.12
53 0.12
54 0.12
55 0.11
56 0.1
57 0.1
58 0.09
59 0.09
60 0.09
61 0.08
62 0.07
63 0.06
64 0.06
65 0.09
66 0.11
67 0.14
68 0.14
69 0.15
70 0.22
71 0.27
72 0.31
73 0.34
74 0.36
75 0.38
76 0.41
77 0.46
78 0.45
79 0.41
80 0.37
81 0.32
82 0.28
83 0.24
84 0.19
85 0.12
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06
94 0.06
95 0.07
96 0.12
97 0.15
98 0.16
99 0.22
100 0.25
101 0.3
102 0.36
103 0.38
104 0.38
105 0.41
106 0.47
107 0.52
108 0.52
109 0.49
110 0.43
111 0.41
112 0.42
113 0.37
114 0.31
115 0.23
116 0.19
117 0.19
118 0.2
119 0.19
120 0.14
121 0.14
122 0.12
123 0.12
124 0.12
125 0.11
126 0.11
127 0.11
128 0.11
129 0.11
130 0.13
131 0.16
132 0.2
133 0.22
134 0.22
135 0.24
136 0.24
137 0.25
138 0.23
139 0.2
140 0.26
141 0.26
142 0.29
143 0.29
144 0.31
145 0.3
146 0.33
147 0.32
148 0.23
149 0.22
150 0.17
151 0.14
152 0.12
153 0.11
154 0.08
155 0.07
156 0.07
157 0.06
158 0.05
159 0.06
160 0.06
161 0.08
162 0.11
163 0.11
164 0.11
165 0.11
166 0.11
167 0.11
168 0.11
169 0.09
170 0.06
171 0.05
172 0.04
173 0.06
174 0.05
175 0.05
176 0.04
177 0.04
178 0.05
179 0.05
180 0.07
181 0.09
182 0.14
183 0.18
184 0.23
185 0.23
186 0.25
187 0.26
188 0.29
189 0.26
190 0.24
191 0.21
192 0.2
193 0.21
194 0.19
195 0.21
196 0.16
197 0.19
198 0.21
199 0.2
200 0.21
201 0.26
202 0.3
203 0.32
204 0.36
205 0.39
206 0.44
207 0.47
208 0.5
209 0.5
210 0.46
211 0.42
212 0.4
213 0.33
214 0.25
215 0.25
216 0.21
217 0.19
218 0.19
219 0.18
220 0.17
221 0.19
222 0.19
223 0.19
224 0.2
225 0.19
226 0.21
227 0.21
228 0.2
229 0.18
230 0.18
231 0.17
232 0.15
233 0.15
234 0.15
235 0.15
236 0.16
237 0.19
238 0.19
239 0.23
240 0.24
241 0.21
242 0.21
243 0.22
244 0.24
245 0.25
246 0.26
247 0.25
248 0.24
249 0.24
250 0.24
251 0.24
252 0.23
253 0.2
254 0.19
255 0.15
256 0.14
257 0.14
258 0.14
259 0.11
260 0.1
261 0.09
262 0.08
263 0.08
264 0.14
265 0.17
266 0.2
267 0.2
268 0.24
269 0.28
270 0.32
271 0.39
272 0.35
273 0.35
274 0.38
275 0.45
276 0.48
277 0.45
278 0.41
279 0.37
280 0.4
281 0.38
282 0.37
283 0.34
284 0.33
285 0.38
286 0.44
287 0.47
288 0.46
289 0.44
290 0.41
291 0.37
292 0.35
293 0.28
294 0.25
295 0.22
296 0.21
297 0.24
298 0.25
299 0.25
300 0.22
301 0.21
302 0.18
303 0.14
304 0.11
305 0.12
306 0.16
307 0.22
308 0.31
309 0.33
310 0.42
311 0.51
312 0.61
313 0.66
314 0.7
315 0.75
316 0.75
317 0.85
318 0.86
319 0.85
320 0.84
321 0.78
322 0.75
323 0.71
324 0.65
325 0.62
326 0.57
327 0.51
328 0.5
329 0.53
330 0.48
331 0.49
332 0.48
333 0.49
334 0.49
335 0.49
336 0.49
337 0.46
338 0.51
339 0.48
340 0.48
341 0.41
342 0.39
343 0.38
344 0.32
345 0.31
346 0.27
347 0.22
348 0.22
349 0.26
350 0.23
351 0.23
352 0.22
353 0.22
354 0.23
355 0.23
356 0.26
357 0.23
358 0.3
359 0.31
360 0.34
361 0.34
362 0.31
363 0.32
364 0.3
365 0.27
366 0.25
367 0.32
368 0.37
369 0.43
370 0.45
371 0.52
372 0.56