Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CGN3

Protein Details
Accession A0A1Y2CGN3   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
109-132LDIDTKNIRKRKRSNNSLNSNVDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 3.5, cyto_pero 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010585  DNA_repair_prot_XRCC4  
IPR014751  XRCC4-like_C  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006310  P:DNA recombination  
GO:0006302  P:double-strand break repair  
Pfam View protein in Pfam  
PF06632  XRCC4  
Amino Acid Sequences MKNENEFLLETNDKLQKEQNEFSKQMDVIINDKKKLEEVYLLKFRELLNEKKRKIKNLMLALKGKEEIINEYKKINQNTFNNDEIKTNNNIDNSNKKEGHINDQKMKELDIDTKNIRKRKRSNNSLNSNVDELLKMKIKWILIQRNPHLKLIIIIQLKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.33
4 0.39
5 0.44
6 0.47
7 0.49
8 0.5
9 0.51
10 0.5
11 0.43
12 0.39
13 0.35
14 0.28
15 0.26
16 0.33
17 0.35
18 0.31
19 0.32
20 0.3
21 0.29
22 0.29
23 0.25
24 0.24
25 0.24
26 0.3
27 0.37
28 0.37
29 0.35
30 0.35
31 0.33
32 0.34
33 0.35
34 0.36
35 0.39
36 0.48
37 0.51
38 0.59
39 0.63
40 0.61
41 0.63
42 0.61
43 0.6
44 0.6
45 0.64
46 0.6
47 0.6
48 0.54
49 0.48
50 0.41
51 0.32
52 0.23
53 0.17
54 0.16
55 0.17
56 0.18
57 0.18
58 0.18
59 0.22
60 0.27
61 0.28
62 0.27
63 0.29
64 0.31
65 0.36
66 0.4
67 0.38
68 0.35
69 0.33
70 0.31
71 0.25
72 0.25
73 0.21
74 0.19
75 0.18
76 0.18
77 0.19
78 0.21
79 0.28
80 0.3
81 0.34
82 0.33
83 0.31
84 0.36
85 0.36
86 0.42
87 0.43
88 0.44
89 0.45
90 0.46
91 0.49
92 0.43
93 0.42
94 0.33
95 0.26
96 0.27
97 0.22
98 0.25
99 0.26
100 0.33
101 0.39
102 0.44
103 0.49
104 0.51
105 0.59
106 0.66
107 0.73
108 0.77
109 0.82
110 0.86
111 0.89
112 0.87
113 0.81
114 0.73
115 0.63
116 0.53
117 0.42
118 0.33
119 0.24
120 0.21
121 0.21
122 0.18
123 0.18
124 0.21
125 0.21
126 0.26
127 0.35
128 0.41
129 0.44
130 0.54
131 0.6
132 0.67
133 0.69
134 0.66
135 0.58
136 0.48
137 0.42
138 0.36
139 0.36