Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2E667

Protein Details
Accession A0A1Y2E667    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
42-70FMKQLKVNSYLKKKNKKKKEKFFFLLFLNHydrophilic
NLS Segment(s)
PositionSequence
53-62KKKNKKKKEK
Subcellular Location(s) mito 14, E.R. 6, plas 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFLVLYINVIFFYVFSKTIYIFYNRNINKFIIIYLLTIFFYFMKQLKVNSYLKKKNKKKKEKFFFLLFLNIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.1
4 0.1
5 0.12
6 0.14
7 0.17
8 0.16
9 0.18
10 0.28
11 0.28
12 0.29
13 0.3
14 0.28
15 0.25
16 0.24
17 0.21
18 0.13
19 0.12
20 0.11
21 0.09
22 0.09
23 0.07
24 0.07
25 0.07
26 0.06
27 0.06
28 0.07
29 0.08
30 0.1
31 0.11
32 0.13
33 0.15
34 0.22
35 0.27
36 0.34
37 0.42
38 0.49
39 0.58
40 0.68
41 0.76
42 0.8
43 0.86
44 0.9
45 0.91
46 0.93
47 0.94
48 0.94
49 0.91
50 0.87
51 0.81
52 0.73