Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2ACE9

Protein Details
Accession A0A1Y2ACE9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
221-247KIQARAMYKNNRAKPKNKNSWKFYSNIHydrophilic
NLS Segment(s)
PositionSequence
154-172KSKKISRAERKRGAKVWKK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.333, mito_nucl 11.166, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
CDD cd09917  F-box_SF  
Amino Acid Sequences MTSNNTCDPFEKLNVRIKGAPRSYTIIHHILFEFTPRELAQMERVCKSWNKAINSDTELWWNKWMSLVWGQKNIMGALPHPKLSEPNLKELALPQNSLTFFELNSSTVGFGSEMDMNSDNISYSSSVVTLTDLSTSSEINYIAKKANSVSSLIKSKKISRAERKRGAKVWKKLTIEEYRKQEVRNVFISLDDDESDSDDTVINQEKTSTSNVRGKLTTEEKIQARAMYKNNRAKPKNKNSWKFYSNISKEWIAFEDYYYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.5
4 0.51
5 0.54
6 0.54
7 0.51
8 0.45
9 0.47
10 0.44
11 0.43
12 0.43
13 0.39
14 0.34
15 0.33
16 0.3
17 0.27
18 0.25
19 0.24
20 0.2
21 0.15
22 0.17
23 0.15
24 0.16
25 0.15
26 0.16
27 0.21
28 0.26
29 0.29
30 0.28
31 0.29
32 0.31
33 0.33
34 0.36
35 0.36
36 0.37
37 0.39
38 0.41
39 0.42
40 0.44
41 0.46
42 0.43
43 0.36
44 0.36
45 0.35
46 0.32
47 0.33
48 0.29
49 0.24
50 0.23
51 0.23
52 0.19
53 0.24
54 0.3
55 0.3
56 0.34
57 0.34
58 0.34
59 0.34
60 0.31
61 0.24
62 0.17
63 0.15
64 0.18
65 0.19
66 0.19
67 0.18
68 0.18
69 0.19
70 0.23
71 0.32
72 0.26
73 0.31
74 0.32
75 0.32
76 0.32
77 0.33
78 0.36
79 0.27
80 0.26
81 0.2
82 0.21
83 0.21
84 0.22
85 0.2
86 0.13
87 0.11
88 0.12
89 0.13
90 0.1
91 0.1
92 0.09
93 0.07
94 0.07
95 0.07
96 0.06
97 0.05
98 0.06
99 0.07
100 0.07
101 0.08
102 0.09
103 0.09
104 0.09
105 0.09
106 0.07
107 0.06
108 0.07
109 0.06
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.06
116 0.05
117 0.05
118 0.05
119 0.05
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.07
126 0.07
127 0.07
128 0.08
129 0.1
130 0.1
131 0.1
132 0.1
133 0.12
134 0.12
135 0.14
136 0.15
137 0.17
138 0.24
139 0.25
140 0.29
141 0.29
142 0.33
143 0.38
144 0.44
145 0.5
146 0.54
147 0.64
148 0.7
149 0.77
150 0.8
151 0.78
152 0.77
153 0.78
154 0.76
155 0.74
156 0.73
157 0.71
158 0.66
159 0.62
160 0.62
161 0.62
162 0.59
163 0.58
164 0.55
165 0.53
166 0.53
167 0.51
168 0.5
169 0.44
170 0.41
171 0.37
172 0.32
173 0.26
174 0.25
175 0.26
176 0.21
177 0.18
178 0.14
179 0.11
180 0.1
181 0.11
182 0.11
183 0.1
184 0.09
185 0.08
186 0.08
187 0.1
188 0.14
189 0.13
190 0.13
191 0.13
192 0.14
193 0.16
194 0.21
195 0.22
196 0.23
197 0.29
198 0.32
199 0.35
200 0.35
201 0.35
202 0.38
203 0.39
204 0.37
205 0.35
206 0.39
207 0.36
208 0.39
209 0.39
210 0.35
211 0.33
212 0.35
213 0.4
214 0.43
215 0.51
216 0.57
217 0.64
218 0.71
219 0.75
220 0.78
221 0.81
222 0.82
223 0.84
224 0.85
225 0.87
226 0.84
227 0.87
228 0.81
229 0.72
230 0.69
231 0.69
232 0.63
233 0.57
234 0.54
235 0.48
236 0.45
237 0.45
238 0.39
239 0.32
240 0.27