Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FAZ9

Protein Details
Accession A0A1Y2FAZ9    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-22KKEIIKKKNLIDYKKCKEELBasic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR040610  SNRNP25_ubiquitin  
IPR029071  Ubiquitin-like_domsf  
Pfam View protein in Pfam  
PF18036  Ubiquitin_4  
Amino Acid Sequences MEKKEIIKKKNLIDYKKCKEELKEILEKLKHETFLKDIKEENFNLEYINLLYKYETGNAYKILIDRGPLPTIEILIKPNATILDLKHQFVKQLNKLYLNNNNNNKDNSKKIKKNFINWTYVWKRYCFSYNGTRLTNDKLTLKEAGFERNTKLQFKKYLYNKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.81
4 0.77
5 0.71
6 0.68
7 0.67
8 0.65
9 0.62
10 0.61
11 0.54
12 0.58
13 0.56
14 0.52
15 0.49
16 0.44
17 0.39
18 0.33
19 0.33
20 0.3
21 0.35
22 0.36
23 0.32
24 0.31
25 0.31
26 0.34
27 0.32
28 0.32
29 0.26
30 0.24
31 0.22
32 0.19
33 0.16
34 0.12
35 0.14
36 0.09
37 0.08
38 0.08
39 0.09
40 0.1
41 0.11
42 0.12
43 0.11
44 0.12
45 0.13
46 0.13
47 0.13
48 0.13
49 0.13
50 0.11
51 0.1
52 0.11
53 0.12
54 0.12
55 0.11
56 0.11
57 0.1
58 0.1
59 0.1
60 0.1
61 0.09
62 0.09
63 0.09
64 0.08
65 0.08
66 0.07
67 0.07
68 0.07
69 0.07
70 0.15
71 0.16
72 0.17
73 0.19
74 0.19
75 0.21
76 0.25
77 0.31
78 0.27
79 0.33
80 0.35
81 0.36
82 0.38
83 0.41
84 0.46
85 0.46
86 0.49
87 0.5
88 0.52
89 0.5
90 0.51
91 0.5
92 0.44
93 0.46
94 0.48
95 0.5
96 0.54
97 0.57
98 0.66
99 0.69
100 0.74
101 0.76
102 0.71
103 0.67
104 0.59
105 0.63
106 0.58
107 0.58
108 0.51
109 0.42
110 0.38
111 0.35
112 0.39
113 0.32
114 0.31
115 0.35
116 0.4
117 0.44
118 0.45
119 0.44
120 0.41
121 0.45
122 0.43
123 0.36
124 0.32
125 0.29
126 0.3
127 0.32
128 0.29
129 0.29
130 0.27
131 0.31
132 0.31
133 0.31
134 0.33
135 0.37
136 0.41
137 0.43
138 0.46
139 0.46
140 0.51
141 0.54
142 0.6
143 0.63