Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1Y0D3

Protein Details
Accession A0A1Y1Y0D3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
85-110RTNQLKTKTSQLKQKYKKKHQKLIKKHydrophilic
NLS Segment(s)
PositionSequence
97-110KQKYKKKHQKLIKK
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIFRFGQIITIGILGGAGGYLIYKSKPSTRRIEAEYYERLEEEKRLQKENGINPTETSNANNQKEELASSSSKSNGSVIDSIKNRTNQLKTKTSQLKQKYKKKHQKLIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.03
4 0.02
5 0.02
6 0.02
7 0.03
8 0.04
9 0.04
10 0.06
11 0.09
12 0.17
13 0.23
14 0.29
15 0.37
16 0.42
17 0.48
18 0.51
19 0.54
20 0.5
21 0.49
22 0.47
23 0.41
24 0.35
25 0.3
26 0.26
27 0.21
28 0.2
29 0.22
30 0.25
31 0.25
32 0.28
33 0.28
34 0.32
35 0.37
36 0.41
37 0.42
38 0.37
39 0.35
40 0.32
41 0.33
42 0.3
43 0.24
44 0.19
45 0.18
46 0.24
47 0.25
48 0.25
49 0.24
50 0.23
51 0.23
52 0.22
53 0.17
54 0.12
55 0.12
56 0.13
57 0.14
58 0.14
59 0.14
60 0.14
61 0.13
62 0.11
63 0.13
64 0.15
65 0.15
66 0.2
67 0.22
68 0.25
69 0.29
70 0.31
71 0.32
72 0.35
73 0.41
74 0.43
75 0.48
76 0.53
77 0.5
78 0.58
79 0.65
80 0.64
81 0.66
82 0.69
83 0.72
84 0.75
85 0.83
86 0.84
87 0.86
88 0.91
89 0.93
90 0.93