Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AEK2

Protein Details
Accession G3AEK2    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
238-264AEEPKETKKSKKAKKDDKKVKFTKELEBasic
273-300VEEKKETKKESKKESKKETKKEEAKEDSBasic
NLS Segment(s)
PositionSequence
232-259KPKKRAAEEPKETKKSKKAKKDDKKVKF
276-303KKETKKESKKESKKETKKEEAKEDSKKK
Subcellular Location(s) cyto_nucl 13.333, nucl 13, cyto 12.5, mito_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR041232  NPL  
IPR046357  PPIase_dom_sf  
IPR001179  PPIase_FKBP_dom  
IPR023566  PPIase_Fpr3/Fpr4-like  
Gene Ontology GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
KEGG spaa:SPAPADRAFT_57832  -  
Pfam View protein in Pfam  
PF00254  FKBP_C  
PF17800  NPL  
PROSITE View protein in PROSITE  
PS50059  FKBP_PPIASE  
Amino Acid Sequences MSEFQLLPTATYNLALKPFDPAAAIEDEFPVTIRLTLAAVDPEAVDDKEEPSTLRLLKRPLLIDDDELDLLDDEAEEDDELDEEEEEEEKVTKKSKKDADEDDDEEEEDDDEEDEDDLDDDDVEEFVICTLSPKVQFQQTLDLTITPQEQVYFVVTGSYPIHLTGNFIEHPANDDDDEDEDYDEDEYDLTPDEDEIIHGYDLNEEYDEESDEEEAKIEEVGDEEEEEEEEEKPKKRAAEEPKETKKSKKAKKDDKKVKFTKELEQGPTGSTLVEEKKETKKESKKESKKETKKEEAKEDSKKKYPTKTLLGGVVTEDRKVGSGTTAKSGNKVGIRYIGKLKNGKVFDKNTSGKPFAFTLGKGECIKGFDLGVAGMAVGGERRVVIPAKMGYGSQALPGIPANSELTFDIKLVSLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.18
4 0.21
5 0.21
6 0.2
7 0.19
8 0.17
9 0.17
10 0.19
11 0.2
12 0.15
13 0.16
14 0.16
15 0.15
16 0.14
17 0.12
18 0.09
19 0.09
20 0.09
21 0.09
22 0.09
23 0.09
24 0.1
25 0.1
26 0.1
27 0.09
28 0.09
29 0.1
30 0.11
31 0.11
32 0.11
33 0.11
34 0.12
35 0.13
36 0.14
37 0.13
38 0.13
39 0.18
40 0.22
41 0.26
42 0.29
43 0.33
44 0.37
45 0.41
46 0.42
47 0.39
48 0.4
49 0.37
50 0.34
51 0.31
52 0.29
53 0.24
54 0.21
55 0.18
56 0.13
57 0.11
58 0.09
59 0.07
60 0.05
61 0.05
62 0.06
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.06
69 0.05
70 0.05
71 0.06
72 0.06
73 0.06
74 0.07
75 0.08
76 0.09
77 0.12
78 0.18
79 0.23
80 0.27
81 0.36
82 0.43
83 0.49
84 0.55
85 0.61
86 0.61
87 0.62
88 0.61
89 0.55
90 0.48
91 0.41
92 0.34
93 0.25
94 0.18
95 0.12
96 0.09
97 0.07
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.05
117 0.06
118 0.08
119 0.1
120 0.12
121 0.15
122 0.19
123 0.21
124 0.21
125 0.28
126 0.26
127 0.27
128 0.25
129 0.23
130 0.19
131 0.19
132 0.18
133 0.1
134 0.1
135 0.08
136 0.08
137 0.08
138 0.09
139 0.08
140 0.07
141 0.07
142 0.07
143 0.09
144 0.09
145 0.09
146 0.08
147 0.08
148 0.09
149 0.08
150 0.09
151 0.08
152 0.1
153 0.1
154 0.11
155 0.11
156 0.1
157 0.13
158 0.13
159 0.13
160 0.1
161 0.1
162 0.1
163 0.11
164 0.12
165 0.09
166 0.08
167 0.07
168 0.07
169 0.07
170 0.06
171 0.05
172 0.04
173 0.04
174 0.04
175 0.05
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.05
183 0.05
184 0.05
185 0.05
186 0.06
187 0.06
188 0.06
189 0.07
190 0.06
191 0.05
192 0.06
193 0.06
194 0.06
195 0.06
196 0.05
197 0.06
198 0.06
199 0.06
200 0.06
201 0.05
202 0.05
203 0.05
204 0.04
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.05
214 0.05
215 0.05
216 0.08
217 0.11
218 0.13
219 0.14
220 0.16
221 0.18
222 0.2
223 0.28
224 0.36
225 0.44
226 0.51
227 0.59
228 0.66
229 0.72
230 0.72
231 0.69
232 0.68
233 0.67
234 0.68
235 0.68
236 0.7
237 0.74
238 0.83
239 0.89
240 0.9
241 0.9
242 0.92
243 0.89
244 0.86
245 0.83
246 0.76
247 0.73
248 0.7
249 0.66
250 0.58
251 0.52
252 0.46
253 0.37
254 0.35
255 0.26
256 0.18
257 0.12
258 0.11
259 0.11
260 0.12
261 0.13
262 0.17
263 0.24
264 0.29
265 0.34
266 0.41
267 0.48
268 0.55
269 0.64
270 0.71
271 0.75
272 0.79
273 0.86
274 0.87
275 0.89
276 0.9
277 0.89
278 0.88
279 0.87
280 0.84
281 0.82
282 0.8
283 0.78
284 0.79
285 0.78
286 0.75
287 0.73
288 0.75
289 0.72
290 0.71
291 0.71
292 0.68
293 0.67
294 0.65
295 0.6
296 0.56
297 0.5
298 0.42
299 0.35
300 0.33
301 0.26
302 0.21
303 0.18
304 0.14
305 0.14
306 0.14
307 0.12
308 0.11
309 0.15
310 0.16
311 0.2
312 0.25
313 0.25
314 0.27
315 0.28
316 0.29
317 0.28
318 0.27
319 0.25
320 0.28
321 0.3
322 0.31
323 0.39
324 0.39
325 0.42
326 0.47
327 0.49
328 0.49
329 0.51
330 0.52
331 0.51
332 0.51
333 0.5
334 0.54
335 0.55
336 0.54
337 0.57
338 0.55
339 0.47
340 0.45
341 0.41
342 0.36
343 0.33
344 0.27
345 0.26
346 0.25
347 0.29
348 0.27
349 0.27
350 0.24
351 0.24
352 0.25
353 0.19
354 0.18
355 0.13
356 0.13
357 0.11
358 0.1
359 0.07
360 0.06
361 0.05
362 0.05
363 0.04
364 0.04
365 0.04
366 0.04
367 0.04
368 0.05
369 0.08
370 0.1
371 0.11
372 0.16
373 0.18
374 0.2
375 0.21
376 0.2
377 0.19
378 0.21
379 0.21
380 0.17
381 0.17
382 0.14
383 0.14
384 0.16
385 0.15
386 0.12
387 0.14
388 0.15
389 0.13
390 0.15
391 0.15
392 0.16
393 0.16
394 0.16
395 0.15