Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BMP0

Protein Details
Accession A0A1Y2BMP0   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
223-247KTIWIIRNYKYRKKKIIIVISKRIIHydrophilic
NLS Segment(s)
PositionSequence
235-237KKK
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
Amino Acid Sequences MNNNSGRRITPYNQINTYYNEEKIFQKYLKKIIAEIYPNKEDFEVKELVNILRLIRKKGIMEIKGFEDENSLEMLIKFYESELQNISLSDICTTISSFIPEESKNFFMDNFNNTHHNISKNNEKNNEKHNIGVDKVNKCNNEKFNNNEIKNIKIKINKDNKKPNLTNNKINNKNKIIKICGRNNFENNNNKKQFMKNNKANINDNNIFNLKIIDIKNLNTKLKTIWIIRNYKYRKKKIIIVISKRIIKIYKKKLLLSFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.51
3 0.49
4 0.53
5 0.47
6 0.41
7 0.36
8 0.34
9 0.34
10 0.36
11 0.36
12 0.32
13 0.37
14 0.4
15 0.46
16 0.49
17 0.47
18 0.44
19 0.44
20 0.47
21 0.46
22 0.47
23 0.46
24 0.45
25 0.44
26 0.44
27 0.39
28 0.34
29 0.28
30 0.26
31 0.22
32 0.18
33 0.19
34 0.2
35 0.2
36 0.21
37 0.2
38 0.16
39 0.2
40 0.22
41 0.24
42 0.25
43 0.28
44 0.26
45 0.33
46 0.4
47 0.37
48 0.38
49 0.37
50 0.36
51 0.36
52 0.35
53 0.28
54 0.21
55 0.18
56 0.15
57 0.13
58 0.1
59 0.08
60 0.08
61 0.09
62 0.07
63 0.07
64 0.06
65 0.06
66 0.11
67 0.11
68 0.13
69 0.14
70 0.15
71 0.15
72 0.15
73 0.16
74 0.11
75 0.11
76 0.1
77 0.08
78 0.07
79 0.07
80 0.07
81 0.08
82 0.07
83 0.08
84 0.08
85 0.09
86 0.11
87 0.11
88 0.13
89 0.15
90 0.16
91 0.15
92 0.15
93 0.15
94 0.15
95 0.17
96 0.17
97 0.17
98 0.17
99 0.19
100 0.19
101 0.21
102 0.21
103 0.21
104 0.21
105 0.22
106 0.3
107 0.34
108 0.38
109 0.43
110 0.44
111 0.46
112 0.49
113 0.52
114 0.42
115 0.38
116 0.36
117 0.3
118 0.28
119 0.29
120 0.29
121 0.27
122 0.3
123 0.32
124 0.32
125 0.33
126 0.38
127 0.39
128 0.4
129 0.4
130 0.42
131 0.47
132 0.54
133 0.51
134 0.51
135 0.46
136 0.44
137 0.44
138 0.4
139 0.36
140 0.33
141 0.36
142 0.39
143 0.49
144 0.53
145 0.58
146 0.67
147 0.69
148 0.73
149 0.72
150 0.72
151 0.73
152 0.71
153 0.71
154 0.7
155 0.74
156 0.74
157 0.76
158 0.74
159 0.7
160 0.72
161 0.67
162 0.63
163 0.59
164 0.57
165 0.61
166 0.62
167 0.63
168 0.61
169 0.62
170 0.62
171 0.61
172 0.61
173 0.62
174 0.6
175 0.62
176 0.58
177 0.55
178 0.53
179 0.55
180 0.58
181 0.58
182 0.62
183 0.6
184 0.67
185 0.72
186 0.73
187 0.72
188 0.66
189 0.64
190 0.58
191 0.5
192 0.44
193 0.39
194 0.34
195 0.29
196 0.25
197 0.16
198 0.17
199 0.17
200 0.19
201 0.2
202 0.22
203 0.3
204 0.35
205 0.39
206 0.34
207 0.35
208 0.31
209 0.35
210 0.38
211 0.36
212 0.39
213 0.43
214 0.5
215 0.54
216 0.62
217 0.65
218 0.7
219 0.75
220 0.76
221 0.77
222 0.76
223 0.8
224 0.8
225 0.83
226 0.83
227 0.82
228 0.82
229 0.8
230 0.79
231 0.71
232 0.65
233 0.61
234 0.6
235 0.61
236 0.62
237 0.64
238 0.64
239 0.7