Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2DRS0

Protein Details
Accession A0A1Y2DRS0    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
26-60SKVFRFCRSKCHKSFKMKRNPRKVRWTKAFRKAAGHydrophilic
107-127FYKNRMKGKKEHERQQNIKTIHydrophilic
NLS Segment(s)
PositionSequence
40-59FKMKRNPRKVRWTKAFRKAA
103-118RERVFYKNRMKGKKEH
Subcellular Location(s) nucl 17, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
IPR011017  TRASH_dom  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRLEKCYFCSSTIYPGHGITFVRNDSKVFRFCRSKCHKSFKMKRNPRKVRWTKAFRKAAGKEMVIDSTFEFEKRRNIPVRYDRDMMATTLKAMKRVQEIRQRRERVFYKNRMKGKKEHERQQNIKTIKKNVELISGPSLKAKELLQKISQKENKTEMDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.3
4 0.26
5 0.25
6 0.19
7 0.2
8 0.2
9 0.22
10 0.22
11 0.23
12 0.26
13 0.31
14 0.35
15 0.34
16 0.39
17 0.45
18 0.45
19 0.55
20 0.6
21 0.65
22 0.67
23 0.74
24 0.75
25 0.77
26 0.87
27 0.86
28 0.88
29 0.89
30 0.9
31 0.91
32 0.93
33 0.9
34 0.91
35 0.9
36 0.89
37 0.89
38 0.89
39 0.87
40 0.87
41 0.86
42 0.78
43 0.77
44 0.69
45 0.66
46 0.59
47 0.5
48 0.41
49 0.34
50 0.32
51 0.23
52 0.21
53 0.13
54 0.11
55 0.11
56 0.09
57 0.09
58 0.09
59 0.15
60 0.17
61 0.24
62 0.28
63 0.3
64 0.37
65 0.45
66 0.51
67 0.5
68 0.49
69 0.43
70 0.39
71 0.38
72 0.3
73 0.23
74 0.16
75 0.12
76 0.15
77 0.15
78 0.15
79 0.15
80 0.17
81 0.22
82 0.27
83 0.34
84 0.39
85 0.48
86 0.54
87 0.63
88 0.66
89 0.6
90 0.64
91 0.61
92 0.62
93 0.63
94 0.65
95 0.65
96 0.68
97 0.76
98 0.76
99 0.75
100 0.73
101 0.74
102 0.75
103 0.73
104 0.75
105 0.77
106 0.79
107 0.82
108 0.81
109 0.8
110 0.74
111 0.72
112 0.69
113 0.66
114 0.62
115 0.6
116 0.58
117 0.5
118 0.51
119 0.45
120 0.43
121 0.42
122 0.37
123 0.32
124 0.3
125 0.29
126 0.23
127 0.23
128 0.22
129 0.24
130 0.28
131 0.33
132 0.38
133 0.45
134 0.48
135 0.57
136 0.61
137 0.57
138 0.58
139 0.59
140 0.55