Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AX51

Protein Details
Accession A0A1Y2AX51   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-34NKSYNKSYNKSYNKSNNNKNSTNDHydrophilic
36-56LASWKNKGQNNNDKNKRWERVHydrophilic
NLS Segment(s)
PositionSequence
325-329PKKKK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005062  SAC3/GANP/THP3_conserved  
Pfam View protein in Pfam  
PF03399  SAC3_GANP  
Amino Acid Sequences MNNKSYNKSYNKSYNKSYNKSYNKSNNNKNSTNDPLASWKNKGQNNNDKNKRWERVGYISRGNSNNKCEDLRQPETQKQFYNYILEKIEKVDFENIKECSLDPILASLRKLREGIVSSGEINEFTIEVFELSSRIALKANNFEELWKSLSYLILTLYENFKYENEQKNNKAEYIKYYLLYLICYLQPRNIEKTFIGNSQEVLSIYNSLSEELKNSPEISFVYEILILFNVAPINYIEFGKLYDKANEYDRILIQCRVPEIRKRTLTLLTKAYFTLPTDDIKKWLIIDNYEDLKTYLFESWKQLPNNTNTDFNKRITKEQITLRVPKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.77
3 0.79
4 0.79
5 0.79
6 0.79
7 0.78
8 0.79
9 0.79
10 0.8
11 0.83
12 0.85
13 0.85
14 0.83
15 0.82
16 0.76
17 0.73
18 0.7
19 0.65
20 0.56
21 0.47
22 0.47
23 0.49
24 0.49
25 0.45
26 0.44
27 0.46
28 0.5
29 0.56
30 0.59
31 0.62
32 0.68
33 0.75
34 0.78
35 0.77
36 0.82
37 0.83
38 0.78
39 0.73
40 0.69
41 0.64
42 0.65
43 0.65
44 0.61
45 0.58
46 0.56
47 0.57
48 0.56
49 0.57
50 0.51
51 0.49
52 0.48
53 0.44
54 0.43
55 0.39
56 0.43
57 0.44
58 0.45
59 0.48
60 0.5
61 0.54
62 0.59
63 0.6
64 0.56
65 0.51
66 0.48
67 0.42
68 0.43
69 0.37
70 0.34
71 0.32
72 0.29
73 0.26
74 0.25
75 0.25
76 0.19
77 0.19
78 0.23
79 0.22
80 0.23
81 0.27
82 0.26
83 0.24
84 0.24
85 0.22
86 0.18
87 0.18
88 0.15
89 0.1
90 0.12
91 0.14
92 0.15
93 0.15
94 0.16
95 0.17
96 0.18
97 0.19
98 0.17
99 0.18
100 0.2
101 0.21
102 0.19
103 0.19
104 0.17
105 0.18
106 0.17
107 0.13
108 0.1
109 0.09
110 0.06
111 0.05
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.05
121 0.06
122 0.07
123 0.08
124 0.1
125 0.16
126 0.17
127 0.18
128 0.18
129 0.18
130 0.18
131 0.19
132 0.19
133 0.13
134 0.12
135 0.1
136 0.11
137 0.11
138 0.09
139 0.08
140 0.07
141 0.08
142 0.08
143 0.09
144 0.09
145 0.09
146 0.09
147 0.09
148 0.12
149 0.19
150 0.27
151 0.31
152 0.36
153 0.39
154 0.45
155 0.46
156 0.44
157 0.38
158 0.3
159 0.28
160 0.29
161 0.27
162 0.21
163 0.2
164 0.2
165 0.18
166 0.18
167 0.14
168 0.09
169 0.09
170 0.11
171 0.11
172 0.12
173 0.15
174 0.18
175 0.23
176 0.22
177 0.23
178 0.22
179 0.26
180 0.26
181 0.24
182 0.25
183 0.19
184 0.19
185 0.18
186 0.18
187 0.14
188 0.13
189 0.11
190 0.09
191 0.09
192 0.1
193 0.09
194 0.09
195 0.09
196 0.08
197 0.1
198 0.1
199 0.11
200 0.11
201 0.12
202 0.11
203 0.12
204 0.12
205 0.13
206 0.13
207 0.12
208 0.11
209 0.11
210 0.11
211 0.1
212 0.1
213 0.07
214 0.06
215 0.06
216 0.06
217 0.05
218 0.06
219 0.06
220 0.07
221 0.08
222 0.08
223 0.08
224 0.08
225 0.09
226 0.11
227 0.13
228 0.13
229 0.16
230 0.18
231 0.2
232 0.24
233 0.26
234 0.25
235 0.26
236 0.26
237 0.26
238 0.27
239 0.27
240 0.25
241 0.23
242 0.25
243 0.27
244 0.29
245 0.34
246 0.38
247 0.45
248 0.47
249 0.48
250 0.49
251 0.52
252 0.55
253 0.52
254 0.53
255 0.44
256 0.42
257 0.4
258 0.37
259 0.3
260 0.25
261 0.24
262 0.18
263 0.21
264 0.24
265 0.25
266 0.26
267 0.26
268 0.26
269 0.22
270 0.26
271 0.25
272 0.22
273 0.25
274 0.29
275 0.31
276 0.3
277 0.29
278 0.24
279 0.22
280 0.21
281 0.19
282 0.17
283 0.16
284 0.18
285 0.23
286 0.31
287 0.37
288 0.39
289 0.43
290 0.46
291 0.5
292 0.55
293 0.52
294 0.54
295 0.5
296 0.56
297 0.55
298 0.52
299 0.55
300 0.5
301 0.54
302 0.54
303 0.56
304 0.54
305 0.59
306 0.65
307 0.63
308 0.69
309 0.71